SecReT6
Protein ID: 564949974
SecReT6 ID877
T6SS typei3
Gene symbol-
Locus tagU769_00425
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]103676..104140 [-]
Producttype VI secretion protein
NoteTssJ
UniProt IDV5SPA5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.00E-43, Aligned region: 11..146
Protein Sequence: 154 a.a.     [Download]
>gi|564949974|ref|YP_008882544.1| type VI secretion protein [Pseudomonas aeruginosa MTB-1]
MQKLIVALFGLLLAACSSSPPETPPTRVVIWLHAAPNLNPSAAGQAAPLRLRLYELKKDTAFGRADYFAL
TDNAQSTLGGDLVEQDEFLLRPGEERRIERTLDEQTRQLGFVAAYRDLDRATWRQVLDVPGQRTSHLDIT
LGAQAIGIVARPAP
 
Nucleotide Sequence: 465 bp     [Download]
>gi|564949884|ref|NC_023019.1|:c104140-103676 Pseudomonas aeruginosa MTB-1, complete genome
ATGCAGAAACTGATCGTCGCGCTGTTCGGGCTGCTGCTCGCCGCCTGTTCGTCCAGCCCGCCGGAAACCC
CGCCGACCCGGGTGGTGATCTGGCTCCACGCCGCACCGAACCTCAACCCGTCCGCCGCCGGCCAGGCGGC
GCCGCTGCGCCTGCGGCTGTACGAGCTGAAGAAAGACACCGCGTTCGGCCGCGCCGACTACTTCGCCCTC
ACCGACAACGCCCAGTCGACCCTCGGCGGCGACCTGGTGGAGCAGGACGAGTTCCTCCTGCGTCCGGGCG
AGGAACGGCGCATCGAACGCACGCTCGACGAGCAGACCCGCCAGCTCGGTTTCGTCGCCGCCTACCGCGA
CCTCGACCGCGCCACCTGGCGCCAGGTCCTCGACGTGCCGGGGCAACGCACCAGCCATCTCGACATCACG
CTCGGCGCGCAGGCCATCGGCATCGTCGCGCGCCCCGCGCCCTGA