SecReT6
Protein ID: 564949975
SecReT6 ID877
T6SS typei3
Gene symbol-
Locus tagU769_00430
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]104185..105684 [-]
Productsignal peptide protein
NoteFha
UniProt IDV5SQX7
KEGG IDpaem:U769_00430
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.50E-15, Aligned region: 29..97
Protein Sequence: 499 a.a.     [Download]
>gi|564949975|ref|YP_008882545.1| signal peptide protein [Pseudomonas aeruginosa MTB-1]
MPLRLTITSYHKLTPGQCSEKVLDQGQLTIGRGPDNDWVLPDPERLVSSRHCTILNRDGVYYLTDTSTNG
VLLVNAGHRLRRGNSEPLQDGETVRLGEYDILVQLGHDIALPGSGNPQTDPFTSFDALMSRQAAGSAPAF
AEPAPTPHPAVTAHFQGGSPLDTKPDLFDFLTPPPPGAAPRPDHVPAEQHDFRPPEPVIPPPPATTPAPP
PAGGAPLIPADWDPFAELLGNTPAPSATPVAQPQPAAEPTPLAMPFADPGITQQPQPQPQPQPQPQPQPQ
PQPQPQPASVAAPTPPASAAATAGGDLLQAFLRGAGMTQLKVDPAGAEAQMEAIGRSYRGLVEGLVDVLR
ARASLKGEFRMTQTMIQPVQNNPLKFAPNVDEAMLLLLRRDNQAFMAPDRAVADSFEDLKAHQLAVMAGV
QAAIRHLLARFEPAALEARFGKPAGLSGLLPGPRQAQNWDSFTELYAKILREAEDDFQELFGREFSRAYE
EHSARLRRS
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|564949884|ref|NC_023019.1|:c105684-104185 Pseudomonas aeruginosa MTB-1, complete genome
ATGCCGCTGCGATTGACCATCACCAGCTACCACAAGCTGACCCCCGGTCAGTGTTCGGAAAAGGTACTGG
ACCAGGGACAGCTGACCATCGGTCGGGGCCCGGACAACGACTGGGTCCTGCCGGACCCGGAGCGCCTGGT
CTCCAGCCGCCACTGCACCATCCTCAACCGCGACGGGGTGTACTACCTCACCGACACCAGCACCAACGGC
GTGCTGCTGGTCAATGCCGGGCACCGCCTGCGCCGCGGCAACAGCGAGCCGCTGCAGGACGGCGAGACCG
TCCGCCTCGGCGAATACGACATCCTCGTCCAGCTCGGCCACGACATCGCCCTGCCCGGCAGCGGCAATCC
GCAGACCGATCCGTTCACCAGCTTCGACGCCCTGATGAGCCGGCAGGCCGCCGGATCGGCGCCTGCCTTC
GCCGAACCGGCGCCCACCCCGCACCCCGCGGTGACGGCGCATTTCCAGGGCGGCTCGCCGCTGGACACCA
AGCCCGACCTGTTCGACTTCCTCACCCCGCCGCCGCCCGGCGCGGCGCCGCGTCCGGACCATGTACCGGC
CGAACAGCACGACTTCCGCCCGCCGGAACCGGTGATCCCGCCGCCCCCCGCGACCACTCCGGCGCCACCG
CCCGCTGGCGGCGCACCGCTGATTCCGGCCGACTGGGACCCGTTCGCCGAACTGCTCGGCAACACGCCCG
CGCCAAGCGCCACGCCCGTCGCCCAGCCGCAGCCAGCGGCCGAACCGACACCGCTGGCGATGCCCTTCGC
CGACCCTGGGATCACCCAACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAG
CCACAGCCACAGCCACAGCCAGCCAGCGTGGCGGCGCCGACGCCCCCGGCAAGCGCCGCCGCGACGGCCG
GCGGCGACCTGCTGCAGGCGTTCCTGCGCGGCGCCGGCATGACCCAGTTGAAGGTCGACCCCGCCGGCGC
CGAAGCGCAGATGGAAGCCATCGGCCGCAGCTATCGCGGCCTGGTGGAAGGACTGGTGGACGTGCTGCGC
GCGCGGGCCAGCCTGAAGGGCGAGTTCCGCATGACGCAGACCATGATCCAGCCGGTGCAGAACAACCCGC
TGAAGTTCGCGCCGAACGTCGACGAAGCCATGCTGCTCCTGCTGCGCCGCGACAACCAGGCGTTCATGGC
GCCGGATCGCGCGGTGGCCGACAGCTTCGAAGACCTCAAGGCGCACCAGCTGGCGGTGATGGCCGGCGTG
CAGGCCGCCATCCGCCACCTGCTGGCGCGCTTCGAACCGGCCGCGCTGGAAGCCCGCTTCGGCAAGCCGG
CCGGGCTTTCCGGCCTGCTGCCGGGGCCCCGCCAGGCACAGAACTGGGACAGTTTCACCGAGCTGTACGC
GAAGATCCTGCGCGAGGCGGAGGACGACTTCCAGGAGCTTTTCGGCCGCGAATTCAGCCGCGCCTACGAG
GAACACAGCGCTCGACTACGGCGTTCCTGA