SecReT6
Protein ID: 564949976
SecReT6 ID877
T6SS typei3
Gene symbol-
Locus tagU769_00435
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]106052..107086 [+]
Producttype VI secretion protein ImpA
NoteTssA
UniProt IDV5SQI4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.50E-18, Aligned region: 54..113
ImpA-rel_N [PF06812], Evalue: 2.50E-18, Aligned region: 156..168
Protein Sequence: 344 a.a.     [Download]
>gi|564949976|ref|YP_008882546.1| type VI secretion protein ImpA [Pseudomonas aeruginosa MTB-1]
MLDVPVLLAAVSPDSPCGDDLEYDAAFLELERIAQGQPERQMGDAVLPAEPPEWPRVRALASELFGRSKD
LRVANLLLQSNVALDGLDGLAEGLLLVRELLGQYWDGVYPLLDADDDNDPTFRINALTGLVAEPLLQLVW
AIPLVRSRAFGPVNLRAALNAAGLQRFASETLSPEQIAGAFADADADALAATRRALDGAQEHALAIESGV
AERVGSAQGLDLGPLRQLLRQALQVFDLYGPQGAGEPLAPGAEAATGEQGGAAPVAAVAAPAPRASGEIA
NREDVLRQLDRLLEYYVRHEPSSPVPVLLKRAKTLVTADFAEIVRNLIPDGISQFETLRGPESE
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|564949884|ref|NC_023019.1|:106052-107086 Pseudomonas aeruginosa MTB-1, complete genome
GTGCTGGATGTACCCGTTTTGCTGGCCGCCGTATCCCCGGACTCGCCCTGTGGCGACGATCTGGAGTACG
ACGCCGCGTTCCTCGAACTCGAACGCATCGCTCAGGGCCAACCCGAGCGCCAGATGGGCGATGCCGTGCT
GCCCGCCGAACCGCCGGAGTGGCCGCGCGTACGCGCGCTGGCCAGCGAGCTGTTCGGCCGTAGCAAGGAC
CTGCGGGTAGCCAACCTGCTGCTGCAGAGCAACGTTGCCCTCGACGGCCTGGACGGGCTCGCCGAAGGCC
TGCTGCTGGTCCGCGAGCTGCTCGGCCAGTACTGGGACGGCGTCTATCCGTTGCTCGACGCCGATGACGA
CAACGACCCCACCTTCCGTATCAACGCCCTCACCGGCCTGGTCGCCGAACCGCTGCTGCAACTGGTCTGG
GCGATCCCGCTGGTGCGCTCGCGGGCGTTCGGCCCGGTCAACCTGCGCGCCGCGCTGAACGCCGCCGGGC
TGCAACGCTTCGCCAGCGAGACCCTGAGTCCCGAGCAGATCGCCGGCGCCTTCGCCGATGCCGACGCCGA
TGCGCTGGCCGCCACCCGGCGCGCCCTGGATGGCGCCCAGGAACATGCCCTGGCCATCGAGAGCGGCGTC
GCCGAACGGGTCGGCTCGGCCCAGGGCCTCGACCTCGGTCCCCTTCGTCAACTGCTGCGCCAGGCCCTCC
AGGTGTTCGACCTGTACGGCCCGCAGGGCGCCGGCGAGCCCTTGGCGCCGGGCGCCGAAGCGGCCACCGG
CGAGCAGGGGGGCGCCGCGCCTGTCGCAGCCGTCGCCGCGCCGGCACCGCGTGCCAGCGGCGAGATCGCC
AACCGCGAAGACGTCCTGCGCCAGCTCGATCGCCTGCTCGAGTATTACGTTCGCCACGAGCCGTCGAGCC
CGGTGCCGGTGCTGCTCAAGCGCGCCAAGACACTGGTGACGGCCGACTTCGCCGAAATCGTGAGGAATCT
CATCCCCGATGGGATTTCCCAGTTCGAAACCCTGCGAGGCCCGGAAAGCGAGTAA