SecReT6
Protein ID: 564949977
SecReT6 ID877
T6SS typei3
Gene symbol-
Locus tagU769_00440
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]107175..107693 [+]
Producthypothetical protein
NoteTssB
UniProt IDV5SNN0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.60E-60, Aligned region: 11..164
Protein Sequence: 172 a.a.     [Download]
>gi|564949977|ref|YP_008882547.1| hypothetical protein U769_00440 [Pseudomonas aeruginosa MTB-1]
MGSTTSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMADLAGKPAEPQAAVADRKFLEIDVDNF
DARLKAMKPRVAFNVPNVLTGEGNLSLDITFESMDDFSPAAVARKVDSLNKLLEARTQLANLLTYMDGKT
GAEEMIMKAIKDPALLQALASAPKPKDDEPQA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|564949884|ref|NC_023019.1|:107175-107693 Pseudomonas aeruginosa MTB-1, complete genome
ATGGGAAGCACTACCAGCAGTCAGAAGTTCATCGCCAGGAACCGGGCGCCACGCGTGCAGATCGAGTACG
ACGTGGAGCTGTACGGTGCCGAGAAGAAGGTCCAGCTGCCCTTCGTCATGGGCGTCATGGCCGACCTCGC
CGGCAAGCCCGCCGAACCCCAGGCGGCGGTCGCCGACCGCAAGTTCCTGGAGATCGACGTGGACAACTTC
GATGCCCGGCTGAAGGCGATGAAGCCGCGGGTGGCCTTCAACGTACCGAACGTGCTGACCGGCGAAGGCA
ACCTGAGCCTGGACATCACCTTCGAGAGCATGGACGACTTCAGCCCCGCCGCGGTGGCGCGCAAGGTCGA
TTCGCTGAACAAGCTGCTCGAGGCGCGTACCCAGCTGGCCAACCTGCTGACCTACATGGATGGCAAGACC
GGCGCCGAGGAAATGATCATGAAGGCGATCAAGGACCCGGCCCTGCTTCAGGCCCTGGCCAGCGCGCCGA
AGCCCAAAGACGACGAGCCGCAGGCGTAA