SecReT6
Protein ID: 564949978
SecReT6 ID877
T6SS typei3
Gene symbol-
Locus tagU769_00445
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]107706..109202 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDV5SPG0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.70E-195, Aligned region: 67..493
Protein Sequence: 498 a.a.     [Download]
>gi|564949978|ref|YP_008882548.1| EvpB family type VI secretion protein [Pseudomonas aeruginosa MTB-1]
MAELSTENLAQGQTTTEQTSEFASLLLQEFKPKTERAREAVETAVRTLAEHALEQTSLISNDAIKSIESI
IAALDAKLTAQVNLIMHHADFQQLESAWRGLHYLVNNTETDEQLKIRVLNISKPELHKTLKKFKGTTWDQ
SPIFKKLYEEEYGQFGGEPYGCLVGDYYFDQSPPDVELLGEMAKISAAMHAPFISAASPTVMGMGSWQEL
SNPRDLTKIFTTPEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEEFAFEEETDGADSSKYAWA
NSAYAMAVNINRSFKLYGWCSRIRGVESGGEVQGLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGF
MPLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCRFAHYLKCIVRDKIGSFKEKDE
MQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVVVEEVEGNPGYYNSKFFLRPHYQLEGLTVSLRLVS
KLPSAKEA
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|564949884|ref|NC_023019.1|:107706-109202 Pseudomonas aeruginosa MTB-1, complete genome
ATGGCCGAATTGAGCACCGAGAACCTGGCCCAGGGCCAGACCACCACCGAGCAGACCAGCGAGTTCGCCA
GCCTGCTGCTGCAGGAGTTCAAGCCCAAGACCGAGCGCGCCCGCGAAGCGGTGGAGACCGCCGTGCGGAC
CCTCGCCGAGCACGCCCTGGAGCAGACCAGCCTGATCTCCAACGACGCGATCAAGTCGATCGAGTCGATC
ATCGCGGCGCTTGACGCCAAGCTCACCGCCCAGGTCAACCTGATCATGCACCACGCCGACTTCCAGCAAC
TGGAAAGCGCCTGGCGCGGCCTGCACTACCTGGTCAACAACACCGAGACCGACGAGCAACTGAAGATCCG
TGTGCTAAACATCTCCAAGCCGGAGCTGCACAAGACCCTGAAGAAATTCAAGGGCACCACCTGGGACCAG
AGCCCGATCTTCAAGAAGCTCTACGAAGAGGAATACGGCCAGTTCGGCGGCGAGCCCTATGGCTGCCTGG
TCGGCGACTACTACTTCGACCAGTCGCCGCCGGACGTCGAGCTGCTCGGCGAGATGGCGAAGATCTCCGC
CGCCATGCACGCGCCGTTCATCTCCGCCGCCTCGCCGACGGTGATGGGCATGGGTTCCTGGCAGGAGCTG
TCCAACCCGCGCGACCTGACCAAGATCTTCACCACCCCGGAATACGCCGGCTGGCGTTCGCTGCGCGAGT
CCGAGGACTCCCGCTACATCGGCCTGACCATGCCGCGCTTCCTGGCGCGCCTGCCCTACGGGGCGAAGAC
CGATCCGGTGGAAGAGTTCGCCTTCGAGGAAGAAACCGACGGCGCCGACAGCAGCAAGTACGCCTGGGCC
AACTCGGCCTACGCGATGGCGGTCAACATCAACCGCTCCTTCAAGCTCTACGGCTGGTGCTCGCGGATCC
GCGGCGTCGAGTCCGGCGGCGAGGTGCAGGGCCTGCCGGCGCACACCTTCCCCACCGACGACGGCGGCGT
GGACATGAAGTGCCCGACCGAGATCGCCATTTCCGACCGCCGCGAGGCGGAGCTGGCGAAGAACGGCTTC
ATGCCGCTGCTGCACAAGAAGAACACCGACTTCGCCGCCTTCATCGGCGCGCAGTCGCTGCAGAAACCCG
CCGAGTACGACGATCCGGACGCTACCGCCAACGCCAACCTGGCGGCGCGCCTGCCCTACCTGTTCGCCAC
CTGCCGCTTCGCCCATTACCTGAAGTGCATCGTTCGCGACAAGATCGGTTCCTTCAAGGAGAAGGACGAG
ATGCAGCGCTGGCTGCAGGACTGGATCCTCAACTATGTCGACGGCGACCCGGCCCACTCCACCGAGACCA
CCAAGGCCCAGCACCCGCTGGCGGCGGCCGAAGTGGTGGTGGAGGAAGTCGAAGGCAATCCGGGTTACTA
CAACTCGAAGTTCTTCCTTCGCCCGCACTACCAGCTCGAGGGACTGACGGTATCGCTACGCCTGGTATCC
AAGCTGCCTTCGGCCAAAGAGGCCTGA