SecReT6
Protein ID: 564949980
SecReT6 ID877
T6SS typei3
Gene symbol-
Locus tagU769_00455
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]109934..110779 [+]
Productvirulence protein, SciE type
NoteTagJ
UniProt IDV5SQY1
KEGG IDpaem:U769_00455
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 7.60E-43, Aligned region: 159..276
TPR_16 [PF13432], Evalue: 1.80E-07, Aligned region: 21..74
TPR_16 [PF13432], Evalue: 1.80E-07, Aligned region: 132..150
TPR_16 [PF13432], Evalue: 1.80E-07, Aligned region: 235..243
TPR_19 [PF14559], Evalue: 2.60E-05, Aligned region: 26..82
TPR_19 [PF14559], Evalue: 2.60E-05, Aligned region: 131..151
TPR_14 [PF13428], Evalue: 0.0001, Aligned region: 20..59
TPR_14 [PF13428], Evalue: 0.0001, Aligned region: 56..73
TPR_14 [PF13428], Evalue: 0.0001, Aligned region: 113..141
TPR_14 [PF13428], Evalue: 0.0001, Aligned region: 237..239
TPR_11 [PF13414], Evalue: 0.0037, Aligned region: 23..71
TPR_11 [PF13414], Evalue: 0.0037, Aligned region: 122..139
BTAD [PF03704], Evalue: 0.007, Aligned region: 14..71
BTAD [PF03704], Evalue: 0.007, Aligned region: 138..144
Protein Sequence: 281 a.a.     [Download]
>gi|564949980|ref|YP_008882550.1| virulence protein, SciE type [Pseudomonas aeruginosa MTB-1]
MADPSFASGRLGSRLQGSIAMIAEELLRAGRLDDALKALQEQVRSQPSNATLRIFLFQLLAVMGQWARAQ
NQLKVVGELDASALPMVQTYSTAIDCEALRREVFAGRLTPVILGQPAEWIAPLLQALSLDAEGHGEAAQA
LREQAFDAAPAVPGRIGEAPFAWLADADTRLGPVLEVIVNGRYAWLPMSNLRSLKVEAPSDLRDLVWLPA
ELTLANGGATVALLPARYAETVEHGDAAARLGRKTEWLDSGLPVGQRLFVTDAGETALFDLRELDFEPTD
A
 
Nucleotide Sequence: 846 bp     [Download]
>gi|564949884|ref|NC_023019.1|:109934-110779 Pseudomonas aeruginosa MTB-1, complete genome
ATGGCCGACCCTTCATTCGCATCCGGGCGCCTGGGCTCCCGGCTACAGGGAAGTATCGCGATGATCGCCG
AAGAACTGTTGCGCGCCGGGCGCCTGGACGATGCCTTGAAAGCCTTGCAGGAACAGGTGCGCAGCCAGCC
GTCGAACGCTACCCTGCGGATCTTCCTGTTCCAGCTGCTGGCCGTGATGGGCCAGTGGGCGCGGGCGCAG
AACCAGCTCAAGGTGGTCGGCGAACTGGATGCCTCGGCGCTGCCGATGGTACAGACCTACTCCACCGCCA
TCGACTGCGAGGCGCTGCGCCGCGAGGTGTTCGCCGGGCGCCTGACGCCGGTGATCCTCGGCCAGCCGGC
GGAATGGATTGCGCCTCTGTTGCAGGCCCTGAGCCTGGATGCCGAAGGCCACGGCGAGGCCGCCCAGGCC
CTGCGCGAGCAGGCCTTCGACGCCGCGCCGGCGGTGCCCGGGCGGATCGGCGAGGCGCCGTTCGCCTGGC
TGGCGGATGCCGACACGCGCCTCGGTCCGGTGCTCGAGGTAATCGTCAACGGTCGCTATGCCTGGTTGCC
GATGAGCAACCTGCGCAGCCTCAAGGTCGAGGCGCCGAGCGACCTGCGCGACCTGGTCTGGCTGCCGGCC
GAACTGACCCTGGCCAACGGCGGCGCCACCGTCGCGCTGCTGCCGGCGCGCTACGCGGAAACCGTCGAGC
ACGGCGACGCCGCCGCGCGCCTGGGGCGCAAGACCGAATGGCTGGACAGCGGCCTGCCGGTCGGCCAGCG
GCTGTTCGTCACCGATGCCGGCGAGACCGCGCTGTTCGACCTGCGTGAGCTGGACTTCGAGCCGACGGAC
GCCTGA