SecReT6
Protein ID: 564949981
SecReT6 ID877
T6SS typei3
Gene symbol-
Locus tagU769_00460
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]110781..111290 [+]
Producthypothetical protein
NoteTssE
UniProt IDV5SQI6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.70E-23, Aligned region: 36..145
Protein Sequence: 169 a.a.     [Download]
>gi|564949981|ref|YP_008882551.1| hypothetical protein U769_00460 [Pseudomonas aeruginosa MTB-1]
MAELTLQERLQPSLLDRLTDDEPGNLKEAAERRVLTLSQLKASVLRDLAWLFNTTSLFDPGPAARMPAGN
SVLNYGLPALAGHTASSVDVHAIEALLTETIATFEPRIIRSSLRVRAQLLPGEMDHNALSFEIEGDLWAE
PAPLRLLLTTNLDLETGHVRVAQGERRRT
 
Nucleotide Sequence: 510 bp     [Download]
>gi|564949884|ref|NC_023019.1|:110781-111290 Pseudomonas aeruginosa MTB-1, complete genome
ATGGCCGAACTGACCCTCCAGGAGCGCCTGCAGCCGTCGCTGCTCGACCGCCTCACCGACGACGAGCCGG
GCAACCTCAAGGAAGCCGCGGAGCGCCGGGTGCTGACCCTGAGCCAGCTGAAGGCCTCGGTGCTGCGCGA
CCTGGCGTGGCTGTTCAACACCACTTCGCTGTTCGACCCCGGCCCCGCCGCACGGATGCCGGCCGGCAAC
TCGGTGCTCAACTACGGGCTGCCGGCGCTGGCCGGGCACACCGCGTCGAGCGTCGACGTGCATGCCATCG
AGGCGCTGCTCACCGAGACCATCGCCACCTTCGAGCCGCGCATCATCCGTTCTTCGCTGCGGGTGCGCGC
GCAACTGCTGCCCGGCGAGATGGACCACAACGCCCTGAGCTTCGAGATCGAGGGTGATCTCTGGGCCGAA
CCGGCGCCGCTGCGCCTGCTGCTGACCACCAACCTGGACCTGGAGACCGGCCACGTGCGCGTCGCCCAGG
GCGAGCGGAGGCGTACATGA