SecReT6
Protein ID: 564949990
SecReT6 ID877
T6SS typei3
Gene symbol-
Locus tagU769_00505
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]121556..123781 [+]
Producttype VI secretion protein ImpA
NoteTssI
UniProt IDV5SQZ0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.50E-89, Aligned region: 29..329
Phage_GPD [PF05954], Evalue: 5.50E-89, Aligned region: 346..396
Gp5_C [PF06715], Evalue: 1.10E-28, Aligned region: 514..534
Gp5_C [PF06715], Evalue: 1.10E-28, Aligned region: 537..560
Gp5_C [PF06715], Evalue: 1.10E-28, Aligned region: 562..584
Gp5_C [PF06715], Evalue: 1.10E-28, Aligned region: 586..608
Gp5_C [PF06715], Evalue: 1.10E-28, Aligned region: 610..632
Gp5_C [PF06715], Evalue: 1.10E-28, Aligned region: 633..656
Gp5_C [PF06715], Evalue: 1.10E-28, Aligned region: 658..675
Gp5_C [PF06715], Evalue: 1.10E-28, Aligned region: 715..731
Phage_base_V [PF04717], Evalue: 6.00E-26, Aligned region: 369..462
Protein Sequence: 741 a.a.     [Download]
>gi|564949990|ref|YP_008882560.1| type VI secretion protein ImpA [Pseudomonas aeruginosa MTB-1]
MALAQQTRLVRVDSPLGAEVLQLQRMEGREELGRPFAYELELISENPDLPLDGLLGKPASLALELHDGSR
RHFHGIVAACSQGSGNGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRS
YREWEYCVQYRETSFDFVSRLMEQEGIYYWFRHERNRHILVLSDAYGAHQSPPNYASVPYYPPTLEQRER
DHFYDWHMAREVQSGSLSLNDYDFQRPGARLEVRSNIARSHAAADYPLYDYPGEYVQSQDGEQYARTRIE
ALQARYERVRLRGRARGLGSGHLFKLSGYPREDQNREYLVVGAEYRVVQELYETGGGGVGAQFESELDCI
DAGQAYRPLPTTPLPIVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWMRVSQAWAGK
NWGSVQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGTKSRSSKGGTPANFNEIRM
EDKKGAEQLFIHAEKNQDIEVENDESHWVGHDRTKTIDHDETVHVKHDRTETVDNNETITIGVDRTEKVG
NNEKISIGANRTEDVGSNETISIGVDRTEKVGSNEKISIGANRTEDVGNDETISIGANRSESVGNNETIS
IGADRSESVGANETIDIGGNQSTSIGKNESRSVGQGRDTSVGKDDSLDVGKSFTLNAGDSITLVTGAASI
RMKKDGSIVISGKNITIDGSGAINVKADKNVVVKGRKILQN
 
Nucleotide Sequence: 2226 bp     [Download]
>gi|564949884|ref|NC_023019.1|:121556-123781 Pseudomonas aeruginosa MTB-1, complete genome
ATGGCACTTGCGCAACAGACCCGCCTGGTCCGGGTCGACAGTCCGCTCGGCGCGGAGGTCCTGCAATTGC
AGCGAATGGAGGGTCGCGAAGAGCTCGGCCGGCCGTTCGCCTACGAGCTGGAACTGATCTCGGAAAACCC
CGACCTGCCACTCGACGGGCTGCTGGGCAAGCCGGCCAGCCTGGCGCTGGAACTGCACGACGGCAGCCGG
CGGCATTTCCACGGCATCGTCGCCGCTTGCAGCCAGGGATCCGGCAACGGCCAGTTCGCCAGCTACCAGG
TCACCCTGCGCCCCTGGCTGTGGCTGCTGACGCGCACCTCCGACTGCCGCATCTTCCAGAACCAGAAGGT
CCCGGACATCATCAAGCAGGTGTTCCGCGACCTCGGCTTCTCCGACTTCGAGGACGCCCTGAGCCGCTCC
TACCGCGAGTGGGAATACTGCGTGCAGTACCGCGAGACCAGTTTCGACTTCGTCAGCCGGCTGATGGAAC
AGGAAGGCATCTACTACTGGTTCCGCCACGAGCGGAATCGGCACATCCTGGTGCTCTCCGACGCCTATGG
CGCGCACCAGAGCCCGCCGAACTACGCCAGCGTGCCCTACTACCCGCCGACCCTGGAACAGCGCGAGCGC
GACCATTTCTACGACTGGCACATGGCGCGCGAGGTGCAGTCCGGCTCACTGAGCCTCAACGACTACGACT
TCCAGCGCCCCGGCGCGCGCCTGGAGGTGCGCTCCAATATCGCCCGTTCGCATGCGGCGGCCGACTACCC
GCTGTACGACTACCCTGGCGAATACGTACAGAGCCAGGACGGCGAGCAGTACGCGCGGACCCGTATCGAA
GCCTTGCAGGCGCGCTACGAACGGGTGCGCCTGCGCGGCCGCGCCCGCGGCCTGGGTTCGGGCCACCTGT
TCAAGCTCAGCGGCTACCCGCGCGAGGACCAGAACCGCGAGTACCTGGTGGTCGGCGCCGAGTACCGGGT
GGTCCAGGAACTCTACGAGACCGGCGGCGGCGGGGTGGGCGCGCAGTTCGAAAGCGAGCTGGACTGCATC
GATGCCGGCCAGGCCTACCGCCCCTTGCCGACCACTCCGCTGCCGATCGTCCGTGGCCCGCAGACCGCGG
TGGTGGTCGGGCCCAAGGGCGAGGAGATCTGGACCGACCAGTATGGCCGGGTCAAGGTGCATTTCCACTG
GGACCGCCACGACCAGTCCAACGAGAACAGCTCCTGCTGGATGCGCGTCTCGCAGGCCTGGGCCGGGAAG
AACTGGGGCTCGGTGCAGATCCCGCGAATCGGCCAGGAAGTGATCGTCAGCTTCCTCGAAGGCGACCCGG
ACCGGCCGATCATCACCGGGCGGGTCTACAACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGC
CACCCAGAGCGGCACCAAGAGCCGTTCGAGCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATG
GAGGACAAGAAGGGCGCCGAGCAGTTGTTCATCCATGCCGAGAAGAACCAGGACATCGAGGTCGAGAACG
ACGAGAGCCACTGGGTCGGCCACGACCGGACCAAGACCATCGACCACGACGAGACGGTGCATGTGAAGCA
CGATCGCACCGAGACCGTGGACAACAACGAGACCATAACCATCGGCGTCGACCGCACCGAGAAGGTCGGC
AACAACGAGAAGATCAGTATCGGCGCGAACCGCACCGAGGACGTCGGCAGCAACGAGACCATCAGCATCG
GCGTTGACCGCACCGAGAAGGTCGGCAGCAACGAGAAGATCAGCATCGGTGCCAATCGCACCGAGGACGT
CGGCAACGACGAGACCATCAGCATCGGCGCGAACCGTAGCGAGTCGGTGGGCAACAACGAGACGATCAGC
ATCGGCGCCGACCGCAGCGAGTCGGTGGGCGCCAACGAGACCATCGACATAGGCGGCAACCAGAGCACCA
GCATCGGCAAGAACGAGTCGCGCAGCGTCGGCCAGGGCCGCGATACCTCGGTGGGCAAGGACGATAGCCT
GGACGTGGGCAAGAGCTTCACGCTCAACGCCGGCGACTCGATCACCCTGGTCACCGGTGCCGCCAGCATC
CGCATGAAGAAGGACGGCAGCATCGTCATCAGCGGCAAGAACATCACCATCGACGGATCCGGGGCGATCA
ACGTCAAGGCCGACAAGAACGTGGTGGTGAAGGGACGCAAGATCCTCCAGAACTGA