SecReT6
Protein ID: 564952549
SecReT6 ID878
T6SS typei4a
Gene symbol-
Locus tagU769_13385
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]2911045..2912061 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDV5SWJ8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-79, Aligned region: 18..318
Protein Sequence: 338 a.a.     [Download]
>gi|564952549|ref|YP_008885119.1| type VI secretion protein [Pseudomonas aeruginosa MTB-1]
MATPGRLAALPLSQRLRRTPQRFELLQALLLLERERPQALPLGTGNAPRAEALRLRGPLLPLFASSEVES
LLDDPQQPVLSTPVFGLGGPDGPLPYAYQEWLQQRARQKDHAPAEFLDLFQHRLLSLLYRVLRKHRVALG
FAVPAATPVQAQLRALSGLLPKALQERLALPDSAVLARTALFAGGRRSLAGFAGLVRQHFGVEARLDAYQ
GAWKEIPAASRSRLQRGGRNLRLGRDAIAGTRTWDEHAGIALSLGPLDAREAARFFPDGDAHGQLASLAA
LYFGPDLDCRLSLLVSGGAPLRLERGAPPRLSWNTGLRRVEDGQRQRIDLDLRQPEVA
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|564949884|ref|NC_023019.1|:c2912061-2911045 Pseudomonas aeruginosa MTB-1, complete genome
ATGGCAACCCCAGGCCGGCTCGCCGCTCTCCCTCTGAGTCAGCGGCTGCGCCGCACGCCGCAGCGCTTCG
AACTGTTGCAGGCGCTGCTGCTGCTCGAACGCGAGCGTCCCCAGGCGTTGCCGCTGGGCACCGGCAACGC
GCCGCGGGCGGAGGCCCTGCGCCTGCGCGGGCCGCTGCTGCCGCTGTTCGCCTCGAGCGAGGTGGAAAGC
CTGCTCGACGACCCGCAGCAACCGGTGCTGTCCACCCCGGTGTTCGGCCTCGGCGGCCCCGACGGCCCGT
TGCCCTATGCCTACCAGGAATGGCTGCAACAGCGTGCCCGGCAGAAGGACCATGCCCCCGCCGAGTTCCT
CGACCTGTTCCAGCACCGCCTGCTCAGCCTGCTCTACCGGGTACTGCGCAAGCATCGCGTGGCGCTCGGT
TTCGCGGTGCCGGCGGCGACCCCGGTGCAGGCGCAGCTACGCGCCCTCAGCGGCCTGTTGCCGAAGGCCC
TGCAAGAGCGCCTGGCGCTGCCGGACAGCGCGGTGCTGGCACGCACCGCGCTGTTCGCCGGCGGGCGTCG
CTCCCTGGCCGGCTTCGCCGGCCTGGTGCGCCAGCACTTCGGCGTGGAGGCACGGCTGGACGCCTACCAG
GGCGCCTGGAAGGAAATCCCCGCGGCCAGCCGCAGCCGGCTGCAACGCGGCGGACGCAACCTGCGCCTGG
GTCGCGACGCCATAGCCGGCACGCGCACCTGGGACGAGCACGCCGGCATCGCCCTCAGTCTCGGTCCGCT
GGATGCCCGCGAAGCCGCCCGCTTCTTCCCCGACGGCGACGCCCATGGCCAGTTGGCCAGCCTCGCCGCG
CTGTACTTCGGCCCCGACCTGGATTGTCGCCTGAGCCTGCTGGTGAGCGGCGGCGCGCCGCTGCGCCTGG
AGCGCGGTGCACCGCCCAGGCTGAGCTGGAACACCGGCCTGCGGCGCGTCGAAGACGGCCAGCGGCAGCG
CATCGATCTCGACCTGCGGCAGCCGGAGGTAGCCTGA