SecReT6
Protein ID: 564952551
SecReT6 ID878
T6SS typei4a
Gene symbol-
Locus tagU769_13395
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]2913802..2914227 [-]
Producttype VI secretion protein
NoteTssE
UniProt IDV5SXS5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-19, Aligned region: 25..116
Protein Sequence: 141 a.a.     [Download]
>gi|564952551|ref|YP_008885121.1| type VI secretion protein [Pseudomonas aeruginosa MTB-1]
MSGALPPLFERLSAEADERPAFDDRALAESVRGELLRLLNTRRPAHARSGILAYGLADWTAVQRLRAEDR
RQLAREVRAAVEHFEPRLQLAEVEVEPDPGNPQRLRIQLGGRLRSGSRLMPALFVIEQGNDGLEVRHERF
D
 
Nucleotide Sequence: 426 bp     [Download]
>gi|564949884|ref|NC_023019.1|:c2914227-2913802 Pseudomonas aeruginosa MTB-1, complete genome
ATGTCCGGAGCCCTGCCGCCGCTGTTCGAGCGCCTCAGCGCCGAGGCCGACGAACGTCCCGCGTTCGACG
ACCGGGCGCTGGCCGAGTCGGTCCGCGGCGAGCTGCTGCGCCTGCTCAACACACGGCGCCCGGCGCATGC
GCGCAGCGGCATCCTCGCCTACGGGCTCGCCGACTGGACCGCTGTGCAACGCCTGCGCGCCGAGGACCGG
CGCCAGCTGGCACGCGAGGTGCGGGCGGCGGTCGAGCATTTCGAGCCGCGCCTGCAACTGGCCGAGGTCG
AGGTCGAACCTGACCCGGGCAATCCGCAGCGCCTGCGTATCCAGCTCGGTGGCCGCCTGCGCAGCGGGTC
GCGCCTGATGCCTGCGCTATTCGTCATCGAACAGGGCAACGATGGCCTCGAGGTGCGCCATGAGCGATTC
GATTGA