SecReT6
Protein ID: 564952554
SecReT6 ID878
T6SS typei4a
Gene symbol-
Locus tagU769_13410
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]2916318..2916863 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDV5SWK3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.30E-52, Aligned region: 9..161
Protein Sequence: 181 a.a.     [Download]
>gi|564952554|ref|YP_008885124.1| type VI secretion protein [Pseudomonas aeruginosa MTB-1]
MAESTQHKLDRVRPPRVQITYDVEIGNAIEKKELPLVVGILADLSGKPDTPPAKLVERRFVDIDRDNFNE
ILSSISPRATLQVDNTISGDDSKLNVELRFNHIEDFDPVNLVKQVVPLRRLFEARQRLRDLLTKLDGNDD
LDQLLQDVVANTEGLQEIKAARPEAEAAPAGDSEPPADQPA
 
Nucleotide Sequence: 546 bp     [Download]
>gi|564949884|ref|NC_023019.1|:c2916863-2916318 Pseudomonas aeruginosa MTB-1, complete genome
ATGGCCGAGAGTACGCAGCACAAGCTGGACCGGGTGCGCCCGCCGCGCGTGCAGATCACCTACGACGTCG
AGATCGGCAACGCCATCGAGAAGAAGGAGCTGCCCCTGGTGGTCGGCATCCTCGCCGACCTCTCCGGCAA
GCCGGATACCCCGCCGGCGAAGCTGGTCGAACGGCGTTTCGTCGACATCGACCGCGACAACTTCAACGAG
ATCCTCTCCTCCATCTCTCCCCGCGCCACCCTGCAGGTCGACAACACCATCAGCGGCGACGACAGCAAGC
TGAACGTCGAGCTGCGCTTCAACCACATCGAGGACTTCGACCCGGTCAACCTGGTGAAGCAGGTGGTCCC
GTTGCGTCGCCTGTTCGAAGCGCGCCAGCGCCTGCGCGACCTGCTGACCAAGCTCGACGGCAACGACGAC
CTCGACCAGTTGCTGCAGGACGTGGTGGCCAACACCGAAGGCCTGCAGGAAATCAAAGCGGCCCGCCCGG
AAGCCGAAGCGGCCCCGGCCGGCGACAGCGAACCCCCGGCCGACCAGCCGGCCTGA