SecReT6
Protein ID: 564952556
SecReT6 ID878
T6SS typei4a
Gene symbol-
Locus tagU769_13420
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]2917607..2918938 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDV5SXS7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.90E-68, Aligned region: 20..411
Protein Sequence: 443 a.a.     [Download]
>gi|564952556|ref|YP_008885126.1| type VI secretion protein [Pseudomonas aeruginosa MTB-1]
MSVLPDAVCWHEGMQLLPQHFQLQGLRAEALAARTGQACNPWFWGVTALELDPSALCAGQVRVLHLEAIL
PDGLPVSVQAGVDAPLEFDLETALAAAEGPLLNVHLAVSPLWRAGQLLPLKGRLQSRVGAPLPDLASGEH
PEPITVWRASLRLVGDDGKADSVCLPLLRVAKEGGAYVSLPYVPPTPLVLPESPLGRRVQSLCARAREKA
LFLGGRLLLAQQAGNQDDAVEVRRQLAALWTRLPEVEGLLASRAASPLALHGSLLGLAGAWAALDPLAGV
PAFEALDFLDLRRGYEPLLDWLERAIESIRAGYRCLPFEQEEQVFSVRLPDPAPRQRLVVGLRMPAGAGE
QAAADWLERAIVASDPHLPLLARQRMSGLARQPMNRQEQVAYSVGDDTRLFVVQGAGDWFDAGQPLRIVA
PVSGVASSPWQIVLFVADGSDNT
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|564949884|ref|NC_023019.1|:2917607-2918938 Pseudomonas aeruginosa MTB-1, complete genome
ATGAGTGTTCTGCCTGACGCGGTGTGCTGGCACGAAGGGATGCAACTGCTTCCCCAGCATTTCCAGTTGC
AGGGATTGCGTGCCGAGGCGCTGGCGGCGCGCACCGGACAGGCCTGCAACCCTTGGTTCTGGGGCGTGAC
CGCCCTGGAACTGGACCCCTCGGCGTTGTGCGCCGGCCAGGTGCGGGTCCTGCACCTCGAAGCGATCCTG
CCCGACGGCCTGCCGGTGAGCGTGCAGGCTGGTGTCGACGCACCGCTGGAGTTCGACCTGGAGACTGCGC
TGGCGGCCGCCGAAGGGCCGCTGCTGAACGTCCACCTGGCGGTCAGTCCGCTGTGGCGGGCGGGTCAGTT
GCTGCCGCTGAAGGGCCGTCTGCAATCGCGGGTCGGCGCGCCGCTGCCGGACCTGGCCAGCGGCGAGCAC
CCCGAGCCGATCACCGTCTGGCGAGCGTCGCTGCGGCTGGTCGGCGACGACGGCAAGGCCGACTCCGTGT
GCCTGCCGTTGCTGCGCGTGGCGAAGGAGGGCGGCGCCTATGTCAGCCTGCCCTACGTCCCGCCGACGCC
ATTGGTGCTGCCGGAGTCGCCCCTGGGCAGGCGCGTGCAGTCGCTCTGCGCGCGGGCCCGGGAGAAGGCG
CTGTTCCTCGGCGGGCGCCTGCTCCTGGCGCAGCAGGCGGGTAACCAGGACGACGCCGTGGAAGTCCGTC
GCCAGCTCGCCGCGCTCTGGACCCGCCTGCCGGAGGTGGAAGGCCTGCTGGCAAGCCGCGCGGCCTCGCC
GCTGGCCCTGCACGGCAGCCTGCTGGGCCTGGCCGGGGCCTGGGCGGCGCTCGATCCGCTGGCCGGCGTG
CCGGCCTTCGAAGCGCTCGACTTCCTCGACCTGCGGCGTGGCTACGAGCCGCTGCTGGACTGGCTGGAGC
GCGCCATCGAGTCGATCCGCGCGGGCTACCGCTGCCTGCCGTTCGAGCAGGAGGAACAGGTGTTTTCCGT
GCGCCTGCCCGATCCGGCGCCGCGCCAGCGCCTGGTGGTCGGCCTGCGGATGCCCGCCGGCGCCGGCGAA
CAAGCGGCGGCTGACTGGCTGGAGCGCGCCATCGTCGCCTCCGATCCGCACCTGCCGTTGCTCGCCCGGC
AGCGCATGAGCGGGCTGGCGCGGCAGCCGATGAATCGCCAGGAACAGGTGGCCTACAGCGTCGGCGACGA
CACCCGTTTGTTCGTCGTGCAGGGCGCCGGCGACTGGTTCGATGCCGGCCAGCCGCTGCGCATCGTCGCG
CCGGTCAGCGGGGTTGCCAGCAGTCCCTGGCAGATCGTGCTGTTCGTCGCCGACGGCAGCGACAACACCT
AG