SecReT6
Protein ID: 564952559
SecReT6 ID878
T6SS typei4a
Gene symbol-
Locus tagU769_13435
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]2923523..2924623 [+]
Producttype VI secretion protein
NoteTssA
UniProt IDV5SWK8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-22, Aligned region: 62..122
ImpA-rel_N [PF06812], Evalue: 1.30E-22, Aligned region: 213..229
ImpA-rel_N [PF06812], Evalue: 1.30E-22, Aligned region: 248..262
Protein Sequence: 366 a.a.     [Download]
>gi|564952559|ref|YP_008885129.1| type VI secretion protein [Pseudomonas aeruginosa MTB-1]
MTLPLSGNALSLEVLLEPIATEQPCGPSLRYDPDYDRLRELRREDDSSLPTGVWQAEAKRADWAAVEQLA
SELLQRRSKDLMLAAWLGEAWLQRGGLGGLQRALVLLAELCERYPEEVHPQAQDGDQSWRVPPIDWLLRR
YAELLHTRLPLMGQGAFAEITLYAWQRLQRQQVASGDSKSAKAALEAAQLQQKKLDEALRAEPLVQWQRK
QASLLACQQQLQRLEQWCDRCLGELAPSCQPLREVIAQWLALLKEFIAMHPQAPLPEEQPPVAEADAAEG
DADGEESVPASAPSGPAGAPTSREDAYRQLLLIADYLARTEPHSPVPYLIKRAVEWGNKPLSELLAELIN
ADSEARRVWSLLGVLP
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|564949884|ref|NC_023019.1|:2923523-2924623 Pseudomonas aeruginosa MTB-1, complete genome
ATGACCCTGCCTCTTTCCGGCAACGCCCTGTCCCTGGAAGTGCTGCTCGAACCCATCGCCACGGAACAGC
CGTGCGGCCCCAGCCTGCGCTACGACCCGGACTACGACCGCCTGCGCGAGTTGCGCCGGGAGGACGACAG
CAGCCTGCCGACCGGCGTCTGGCAGGCGGAAGCCAAGCGCGCCGACTGGGCCGCGGTGGAGCAGTTGGCC
AGCGAACTGTTGCAGCGGCGCAGCAAGGACCTGATGCTCGCCGCCTGGCTCGGCGAGGCCTGGCTGCAAC
GCGGCGGGCTGGGCGGATTGCAGCGCGCGCTGGTGCTGCTGGCGGAACTCTGCGAGCGCTACCCCGAGGA
GGTGCATCCGCAAGCCCAGGACGGCGACCAGTCGTGGCGGGTGCCGCCCATCGACTGGCTGTTGCGCCGC
TATGCCGAGCTGCTGCACACGCGCCTGCCGCTGATGGGGCAGGGCGCCTTCGCCGAGATCACCCTCTATG
CCTGGCAGAGGTTGCAGCGCCAGCAGGTCGCCAGCGGCGACAGCAAGAGCGCCAAGGCGGCGCTGGAAGC
GGCGCAACTTCAGCAGAAGAAGCTCGACGAAGCGTTGCGCGCGGAGCCCCTGGTGCAATGGCAGCGCAAG
CAGGCCAGCCTGCTCGCCTGCCAGCAGCAACTGCAACGCCTGGAACAGTGGTGTGACCGCTGCCTAGGCG
AACTCGCCCCCAGTTGCCAGCCGCTGCGCGAGGTCATCGCGCAATGGCTGGCCTTGCTCAAGGAGTTCAT
CGCCATGCACCCGCAAGCGCCGCTGCCCGAAGAACAGCCACCGGTCGCGGAGGCGGACGCCGCCGAAGGC
GACGCGGACGGCGAGGAAAGCGTCCCGGCGAGCGCGCCGAGCGGACCGGCTGGCGCGCCGACCAGTCGCG
AGGACGCCTATCGGCAACTGCTGCTGATCGCCGACTACCTGGCGCGCACCGAGCCGCACAGCCCGGTTCC
CTACCTGATCAAGCGCGCGGTGGAATGGGGCAACAAGCCGCTGAGCGAGCTGCTGGCGGAGCTGATCAAT
GCGGACTCGGAGGCGCGCCGGGTCTGGTCGCTGCTTGGCGTACTGCCCTAA