SecReT6
Protein ID: 564953356
SecReT6 ID879
T6SS typei1
Gene symbol-
Locus tagU769_17390
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]3765887..3766756 [-]
ProductOmpA family protein
NoteTssL
UniProt IDV5T002
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.30E-69, Aligned region: 61..266
Protein Sequence: 289 a.a.     [Download]
>gi|564953356|ref|YP_008885926.1| OmpA family protein [Pseudomonas aeruginosa MTB-1]
MIKEREYHEDEKTVLLDHQGQVPAQGPLTDFAEPPRFEQLEERMIYAARLRPGEAFNVSLNPLVAAASEL
LSEVVRLKHSSVLENLAALKERLTSAMKLFEFRAVQDGVENSQVMAARYVLCTVVDEAVVTTPWGNESEW
SKISLLSSFHNETFGGEKFFQLLDRLSKNPVKHLPMLELMYLCLALGFEGKYRVMARGVLDLDGISDALY
RQIRQLRGDVPRELSPHWQGLSDQRRGLVRIVPWWMVALFTLVCLVVMYSGFAWVLGEQRDTVLQPYQSL
DAAAGQPGS
 
Nucleotide Sequence: 870 bp     [Download]
>gi|564949884|ref|NC_023019.1|:c3766756-3765887 Pseudomonas aeruginosa MTB-1, complete genome
ATGATCAAGGAAAGGGAATACCACGAGGACGAGAAGACCGTCCTCCTCGATCACCAGGGACAGGTACCGG
CCCAGGGGCCGCTGACCGATTTCGCCGAACCGCCGCGCTTCGAGCAGCTCGAGGAGCGGATGATCTACGC
GGCGCGCCTGCGTCCGGGCGAGGCCTTCAACGTCAGCCTGAACCCGCTGGTGGCGGCGGCTTCCGAACTG
CTTTCGGAAGTGGTCCGGCTCAAGCACAGCAGCGTGCTGGAGAACCTTGCGGCGCTCAAGGAGCGGTTGA
CCTCCGCCATGAAGCTCTTCGAATTCCGCGCCGTGCAGGATGGCGTGGAAAACAGCCAGGTCATGGCGGC
GCGCTACGTGCTGTGCACGGTGGTCGACGAGGCGGTGGTGACCACCCCGTGGGGCAACGAAAGCGAATGG
TCGAAGATCAGCCTGCTGAGCAGCTTCCATAACGAGACCTTCGGCGGCGAGAAGTTCTTCCAGTTGCTCG
ACCGGCTGTCGAAGAACCCGGTCAAGCATCTGCCGATGCTGGAGCTGATGTACCTCTGCCTGGCCCTCGG
CTTCGAGGGCAAGTACCGGGTGATGGCTCGCGGCGTGCTCGACCTGGACGGTATTTCCGATGCGCTCTAC
CGGCAGATCCGCCAGTTGCGCGGCGACGTGCCGCGCGAACTGTCGCCGCACTGGCAGGGGCTCAGCGACC
AGCGTCGCGGCCTGGTGCGGATCGTGCCCTGGTGGATGGTGGCGCTGTTCACCCTGGTCTGCCTGGTGGT
GATGTATTCGGGATTCGCCTGGGTTCTCGGCGAGCAACGCGACACGGTGCTGCAGCCTTACCAGTCGCTC
GATGCTGCGGCAGGACAGCCCGGTTCGTAA