SecReT6
Protein ID: 564953357
SecReT6 ID879
T6SS typei1
Gene symbol-
Locus tagU769_17395
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]3766759..3768090 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDV5SY71
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.20E-144, Aligned region: 18..442
Protein Sequence: 443 a.a.     [Download]
>gi|564953357|ref|YP_008885927.1| type VI secretion protein [Pseudomonas aeruginosa MTB-1]
MNVHKIVWQEGMLLRPQHLQHNDRYYDNQMKARTQLLGSYNWGFLALELDRQFLNMGKLVISQASGVLPD
GSLFELGGNTEPLALDVPPNTSNVPIYLALPLVTGNHIEARRPEQAEVLARYTAYDLEVADSNAGEDSMV
QVSCARPDFRLLLGEQQSDQAYVKLKVAVVLDTTPDGVISLDPDFVPSYLHAHASAYLLSCLKEVISMLG
HRGDTIAERIRSNGKVGGAEVGDFMMLQLINRTELLLRHYLGLEQVHPEQLYRVLLTMLGDLATFGSESK
RPRLDSRYQHSDQGASFRRLMEAIRQVLSMVLEQHAIELPLQARQYGILVSPLHDHKLLGSASFVLAASA
NCESEELRQRLPAHLKVGAVEHIRQLVNLHLPGIRVKPLPVAPRQIPFHSNKTYFILEPNAEDMTQLERS
GGFAFHVSGEFSELELKFWAIRN
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|564949884|ref|NC_023019.1|:c3768090-3766759 Pseudomonas aeruginosa MTB-1, complete genome
ATGAACGTGCACAAGATCGTCTGGCAGGAAGGCATGCTGCTGCGCCCGCAGCATCTGCAACACAACGACC
GCTACTACGACAACCAGATGAAGGCCCGGACCCAGTTGCTGGGCAGCTACAACTGGGGCTTCCTCGCCCT
GGAGCTGGACCGCCAGTTCCTCAACATGGGCAAGCTGGTGATCAGCCAGGCCTCCGGCGTACTGCCCGAC
GGCAGCCTGTTCGAACTCGGCGGCAACACCGAGCCGCTCGCCCTCGACGTGCCGCCCAATACCTCGAACG
TGCCGATCTACCTGGCCCTGCCGCTGGTCACCGGTAACCACATCGAGGCGCGCCGGCCGGAGCAGGCCGA
GGTCCTGGCGCGCTATACCGCCTACGATCTGGAGGTGGCGGACTCCAACGCCGGCGAGGATTCCATGGTG
CAGGTCAGCTGCGCGCGGCCGGATTTTCGCCTGCTGCTCGGCGAGCAGCAGAGCGACCAGGCCTACGTCA
AACTGAAGGTGGCGGTGGTGCTGGATACCACGCCGGACGGGGTGATCAGCCTCGACCCCGACTTCGTGCC
GAGCTACCTCCACGCCCACGCATCCGCCTACCTGCTGTCCTGCCTGAAGGAGGTGATCAGCATGCTCGGC
CATCGCGGCGACACCATCGCCGAGCGTATCCGGTCCAATGGCAAGGTCGGCGGCGCGGAGGTCGGCGATT
TCATGATGCTGCAACTGATCAATCGCACCGAGTTGCTGCTGCGCCACTACCTGGGATTGGAGCAGGTGCA
TCCGGAGCAGTTGTACCGGGTGCTGCTGACCATGCTCGGCGACCTCGCCACCTTCGGCAGCGAGAGCAAG
CGTCCGCGCCTGGACAGCCGTTACCAGCACAGCGACCAGGGCGCCAGCTTCCGCAGGCTGATGGAGGCGA
TTCGCCAGGTCCTGTCGATGGTGCTCGAGCAGCATGCCATCGAACTGCCTCTCCAGGCCCGCCAGTACGG
CATCCTGGTCTCGCCCCTGCACGACCACAAGCTGCTCGGCAGCGCCTCGTTCGTGCTCGCCGCCAGTGCC
AATTGCGAGTCGGAGGAACTGCGCCAGCGCCTGCCCGCGCATCTCAAGGTGGGTGCGGTCGAGCACATTC
GCCAGTTGGTCAACCTGCACCTGCCGGGGATCCGGGTCAAGCCGCTGCCGGTGGCGCCGCGGCAGATCCC
GTTCCACTCCAACAAGACCTATTTCATTCTCGAACCCAACGCCGAGGATATGACCCAGCTGGAGCGCTCC
GGCGGTTTCGCGTTCCACGTATCCGGCGAGTTCTCCGAGCTTGAACTGAAATTCTGGGCCATCAGGAACT
GA