SecReT6
Protein ID: 564953358
SecReT6 ID879
T6SS typei1
Gene symbol-
Locus tagU769_17400
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]3768087..3768593 [-]
Producttype VI secretion protein
NoteTssJ
UniProt IDV5SZ01
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.30E-42, Aligned region: 19..154
Protein Sequence: 168 a.a.     [Download]
>gi|564953358|ref|YP_008885928.1| type VI secretion protein [Pseudomonas aeruginosa MTB-1]
MSRRPIPPARALAMLAVLALLAGCSTLSPYSRLTKLDLALSAGERVNPDLNGRPSPVVVRLFELKHPVAF
ENADFFSLYERPKETLDPDLVTSEELELRPGERVELKLSVEEGSRYVGVLAAYRDLGEASWRYVVPVTAK
ELTRVELKLGRKGILNAGELLGKAGDAR
 
Nucleotide Sequence: 507 bp     [Download]
>gi|564949884|ref|NC_023019.1|:c3768593-3768087 Pseudomonas aeruginosa MTB-1, complete genome
ATGTCTCGTCGCCCGATTCCGCCAGCCAGGGCGCTGGCCATGCTCGCCGTCCTGGCGCTGCTGGCCGGCT
GTTCCACGCTGTCGCCGTATTCCAGACTGACCAAGCTCGACCTCGCCCTGAGCGCCGGCGAGCGGGTCAA
TCCCGACCTCAATGGCCGGCCGTCGCCGGTGGTAGTGCGGCTGTTCGAGCTGAAGCACCCGGTGGCGTTC
GAGAACGCCGACTTCTTCAGCCTCTACGAACGTCCCAAGGAGACCCTGGACCCCGACCTGGTGACCAGCG
AGGAGCTGGAGCTGCGGCCCGGCGAGCGGGTCGAACTCAAACTCAGCGTGGAGGAGGGGAGCCGCTACGT
GGGCGTGCTCGCCGCCTACCGCGATCTCGGCGAGGCAAGCTGGCGCTACGTGGTGCCGGTCACGGCGAAA
GAGCTGACCCGGGTAGAGCTGAAGCTGGGCCGGAAGGGCATCCTGAATGCCGGCGAACTGCTCGGCAAGG
CGGGTGACGCGCGATGA