SecReT6
Protein ID: 564953363
SecReT6 ID879
T6SS typei1
Gene symbol-
Locus tagU769_17430
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]3774201..3775208 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDV5SZ06
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.90E-88, Aligned region: 19..321
Protein Sequence: 335 a.a.     [Download]
>gi|564953363|ref|YP_008885933.1| type VI secretion protein [Pseudomonas aeruginosa MTB-1]
METAHGFAAPAVSALARGIREYSLFQAVLLVMDRLREEYPGLGDEALYDQLEFQANPSLGFPGSDVDRVE
FFEERGMLRARLRFNLIGLFGASSPLPAFYSEQALGDSEEGNPTRNFLDLFHHRLHRLLLPIWRKYRYRV
SFQSGASDAFSAQLFALVGLGGEEIRKARELNWKRLLPYLGLLSLRAHSAALIESVLRYYFKHAELLAEQ
CIERRVAILEEQRNRLGLFNSQLGEDAVLGERVRDRSGKFRIHIRQLDWQRFHEFLPIGPGYQPLCALVR
FTLRDPLDYDIRLVLRHEEIREFRIGAQNACRLGWTSWLGRERADGVVTLGSKIH
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|564949884|ref|NC_023019.1|:c3775208-3774201 Pseudomonas aeruginosa MTB-1, complete genome
ATGGAAACCGCGCATGGGTTTGCAGCCCCTGCTGTAAGCGCGCTGGCCCGGGGCATTCGCGAGTACTCGC
TGTTCCAGGCGGTCCTGCTGGTCATGGATCGCCTGCGCGAGGAATATCCCGGCCTGGGAGACGAGGCGCT
CTACGATCAGTTGGAATTCCAGGCCAATCCTAGCCTCGGCTTCCCGGGCAGCGATGTCGATCGGGTGGAG
TTCTTCGAAGAGCGTGGCATGCTGCGGGCGCGGCTGCGTTTCAACCTGATCGGCTTGTTCGGTGCCAGTT
CGCCGTTGCCGGCGTTCTACAGCGAGCAGGCCCTGGGCGACAGCGAGGAGGGCAATCCTACGCGGAACTT
CCTCGATCTCTTCCATCACCGCCTGCATCGGCTGCTGTTGCCGATCTGGCGCAAGTACCGTTACCGGGTG
AGCTTCCAGAGCGGTGCGAGCGATGCGTTCTCCGCTCAGTTGTTCGCCCTCGTCGGATTGGGCGGGGAAG
AGATCCGCAAGGCCAGGGAACTGAACTGGAAACGCCTGCTGCCCTACCTGGGCCTGCTCAGCCTGCGGGC
GCACTCGGCGGCCTTGATCGAGTCGGTGCTGCGCTACTACTTCAAGCATGCCGAACTGCTCGCCGAGCAG
TGTATCGAACGGCGCGTCGCGATCCTCGAAGAGCAGCGCAACCGACTCGGCCTGTTCAACAGCCAGCTTG
GCGAAGACGCGGTGCTGGGCGAACGGGTCCGCGACCGCAGCGGCAAGTTCCGCATTCATATCCGCCAGCT
CGACTGGCAGCGCTTCCACGAGTTCCTGCCGATCGGTCCCGGCTACCAGCCGCTTTGCGCGCTGGTCCGC
TTCACCCTGCGCGACCCGCTCGACTACGACATACGGCTGGTCTTGCGCCACGAGGAAATCCGCGAGTTCC
GCATCGGCGCGCAGAACGCCTGCCGCCTTGGCTGGACCAGTTGGCTGGGCCGAGAGCGCGCCGATGGCGT
GGTGACGCTGGGCAGCAAGATTCATTAA