SecReT6
Protein ID: 564953364
SecReT6 ID879
T6SS typei1
Gene symbol-
Locus tagU769_17435
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]3775172..3776959 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDV5SYU6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.10E-184, Aligned region: 3..595
Protein Sequence: 595 a.a.     [Download]
>gi|564953364|ref|YP_008885934.1| type VI secretion protein [Pseudomonas aeruginosa MTB-1]
MSFNHYYQSELTALRQLGRRFAERSPALAPFLGQVGRDPDVERLLEGFAFLTGRLRQKLDDELPELSHSM
MHLLWPNYMRPLPAFSILQFDPLTRPGGALRVERDTPVESRPVGEVACRFRTCYATEVLPLVLEALNYSV
TGEGALLGLRLAMNCDGHLGELGLSRLRLHLAGERYISQMLYLCLLRNLESIQLIPLDAHGRPLDGVAGK
PMSFRLTGERVQPVGFAEDEALIPYPLNTFRGYRYLQEYFAFQDKFLFVDVDGLDLLGALPEETLKQVRG
LELRFDIRKSGIQRLHPTLENVKLYCTPVANLFRHDALPIRLDGKQDEYLLMPAEYSLEDCGVFSVEGVT
GWRPGGLGYQAYVPFESFEHDPSFDVPEARPHYSVRQRTSLLHDGLDTYLSFGIRHPEQIETLSVELTCT
NQNLPQRLRLGDICVACEGTPEFLGFRNITPATPSYAPPLNRDFLWKLISNMSLNYLSLANVDALKVILE
TYDLPRYYDQHAAKVSKRLLGGLKAVRHEHVDRLHRGLPLRGLRTELTIDPEGYIGEGDLFVFASVLNEF
FALYASINSYHELRVRSTQGDVYQWKPRMGLQPLL
 
Nucleotide Sequence: 1788 bp     [Download]
>gi|564949884|ref|NC_023019.1|:c3776959-3775172 Pseudomonas aeruginosa MTB-1, complete genome
GTGTCCTTCAATCATTACTACCAGAGCGAACTCACCGCACTGCGCCAGCTGGGGCGCCGTTTCGCCGAGC
GTAGCCCGGCCCTGGCCCCGTTTCTCGGGCAGGTCGGACGCGATCCGGATGTCGAGCGCCTGCTCGAGGG
CTTTGCCTTCCTGACCGGGCGGTTGCGGCAGAAGCTGGACGACGAGTTGCCGGAACTCAGCCACTCGATG
ATGCACCTGCTGTGGCCGAACTATATGCGCCCGCTGCCGGCTTTCAGCATTCTCCAGTTCGACCCCCTGA
CCCGCCCGGGCGGGGCGCTGCGCGTGGAGCGCGATACGCCGGTCGAGAGCCGGCCGGTGGGCGAGGTCGC
CTGTCGCTTCCGTACCTGCTACGCCACCGAGGTCCTGCCGCTGGTGCTGGAGGCGCTCAACTATTCGGTG
ACCGGCGAGGGAGCGCTGCTCGGCCTGCGCCTGGCGATGAACTGCGACGGGCACCTCGGCGAGCTGGGCC
TGAGTCGGCTGCGCCTGCACCTGGCCGGCGAGCGCTACATCAGCCAGATGCTCTACCTGTGCCTGCTGCG
CAACCTGGAGAGCATCCAGCTGATTCCGCTGGACGCCCATGGGCGGCCGCTGGATGGCGTGGCCGGCAAG
CCGATGTCGTTCCGCCTGACGGGCGAGCGGGTGCAGCCGGTGGGTTTCGCCGAAGACGAGGCGTTGATTC
CCTATCCGCTGAATACCTTCCGTGGCTATCGCTACCTGCAGGAGTACTTCGCGTTCCAGGACAAGTTCCT
GTTCGTCGACGTGGATGGCCTGGACCTGCTCGGCGCGCTGCCCGAGGAAACCCTCAAGCAGGTCCGCGGC
CTCGAGTTGCGCTTCGATATCCGCAAGAGCGGCATCCAGCGCCTGCACCCGACGCTGGAGAACGTCAAGC
TGTACTGTACGCCGGTGGCCAACCTGTTCCGCCACGATGCGCTGCCGATCCGCCTCGACGGCAAGCAGGA
CGAGTACCTGCTGATGCCGGCCGAATACAGCCTGGAGGACTGCGGGGTGTTCTCGGTAGAAGGCGTCACT
GGCTGGCGGCCGGGCGGGCTCGGCTACCAGGCTTACGTACCGTTCGAGTCCTTCGAGCACGATCCCAGCT
TCGACGTTCCCGAAGCACGGCCCCACTACAGCGTCCGGCAACGGACCTCGTTGCTGCACGATGGCCTGGA
CACCTACCTGAGCTTTGGCATCCGCCATCCCGAGCAGATCGAGACGCTGTCGGTGGAACTGACCTGCACC
AACCAGAACCTGCCCCAACGGCTGCGCCTGGGCGATATCTGCGTCGCCTGCGAAGGCACGCCGGAATTCC
TCGGTTTCCGCAATATCACTCCGGCGACGCCGAGCTACGCGCCGCCGCTGAACCGCGATTTCCTCTGGAA
GCTGATCAGCAACATGTCGCTCAACTACCTGTCGCTGGCCAACGTCGACGCGCTCAAGGTGATCCTCGAA
ACCTACGACCTGCCGCGCTACTACGACCAGCATGCGGCGAAGGTCAGCAAGCGCCTGCTGGGCGGGCTCA
AGGCGGTCCGCCACGAGCATGTCGACCGCCTGCATCGGGGCCTGCCGCTGCGCGGCTTGCGTACCGAGCT
GACGATCGATCCGGAAGGCTACATCGGCGAGGGCGACCTGTTCGTGTTCGCTTCGGTTCTGAACGAATTT
TTCGCGCTTTACGCCAGCATCAACTCCTACCACGAGTTGCGGGTGAGGAGCACACAGGGAGACGTGTACC
AATGGAAACCGCGCATGGGTTTGCAGCCCCTGCTGTAA