SecReT6
Protein ID: 564954407
SecReT6 ID880
T6SS typei1
Gene symbol-
Locus tagU769_22665
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]4860305..4861747 [-]
Productmembrane protein
NoteTssA
UniProt IDV5T195
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.70E-15, Aligned region: 54..114
ImpA-rel_N [PF06812], Evalue: 8.70E-15, Aligned region: 392..412
ImpA-rel_N [PF06812], Evalue: 8.70E-15, Aligned region: 408..444
Protein Sequence: 480 a.a.     [Download]
>gi|564954407|ref|YP_008886977.1| membrane protein [Pseudomonas aeruginosa MTB-1]
MSLVMQLPPLDLKALLAPLDERQPAGTFNEEDELLQDIDLEMVKLGGLQERAIDWSFVDEAARRYLGNQC
KHFRIAGHLMTVRLRIGSWRSWSEAAAVLAGMVERYWETGHPKPGATGYLNKRRLVVQYLERLGDALPSL
DSKGYAEDFYKAGQQALDSLQTSAPLAKLDVSELSKLEAKLRQHAESNRAPELAEQSAELPTMSESLSDA
FFMPIQANPGNERENRRSLLAAAEIINQQDAYDPTGYLLRRFALWAHLTQAPSTRKDNRTELMAVPPDAA
DGYGKALSTNSIDPALLLRVERSVASSPYWLRGSYLSAGIARQLDMPRVAEAIRQAAERFVTRLPALTKL
EFADGRPFVDGDTQAWLSGAEAGTGTAVAGAGLEYPVLRDELRAQLESGGVESMLRGLESLQQRTTDLRH
ACHVMAIAAELLASRGLSWLAEGLFARAHGVMDGASARAWEPELYALLAQHASAVAERKD
 
Nucleotide Sequence: 1443 bp     [Download]
>gi|564949884|ref|NC_023019.1|:c4861747-4860305 Pseudomonas aeruginosa MTB-1, complete genome
ATGTCACTGGTGATGCAGCTTCCCCCTCTAGACCTCAAGGCATTGCTGGCACCACTGGATGAGCGCCAGC
CCGCGGGTACCTTCAATGAAGAGGACGAACTGCTCCAGGACATCGACCTCGAGATGGTCAAACTCGGTGG
TCTCCAGGAGCGGGCCATTGATTGGAGCTTCGTGGACGAGGCGGCGCGGCGATATCTGGGTAACCAGTGC
AAACACTTTCGCATCGCCGGGCACCTGATGACGGTTCGCCTGCGCATAGGTAGCTGGCGAAGCTGGTCCG
AGGCCGCAGCCGTGCTGGCCGGCATGGTTGAGCGTTACTGGGAAACAGGACATCCAAAGCCCGGAGCAAC
TGGCTATCTGAACAAGCGCCGATTGGTCGTCCAGTACCTTGAGCGGCTGGGCGATGCCCTGCCTTCTTTG
GACAGCAAGGGCTATGCCGAGGACTTCTACAAAGCCGGTCAGCAGGCACTCGACAGCCTCCAGACAAGCG
CGCCACTGGCCAAACTGGATGTGTCGGAACTGAGCAAGCTGGAAGCCAAGCTGCGCCAGCATGCCGAATC
CAATCGCGCGCCCGAGCTGGCCGAGCAGTCCGCCGAGCTGCCGACAATGAGCGAGTCGCTGTCGGACGCC
TTCTTCATGCCCATCCAGGCCAATCCGGGCAATGAGCGGGAAAACCGGCGTTCGCTGCTGGCGGCAGCCG
AGATCATCAACCAGCAGGATGCCTACGACCCGACCGGCTACCTGCTGCGGCGGTTTGCCCTATGGGCGCA
CCTGACCCAGGCGCCCTCGACGCGCAAGGACAACCGTACGGAGTTGATGGCCGTTCCACCGGATGCCGCA
GACGGCTACGGCAAAGCCTTGAGCACCAACAGCATCGACCCGGCGCTGTTGCTGAGGGTAGAGCGCAGCG
TCGCATCGTCCCCTTATTGGCTGCGCGGCAGCTATCTGTCGGCGGGCATCGCCCGCCAGTTGGACATGCC
GCGGGTGGCTGAGGCAATTCGGCAGGCTGCCGAACGCTTCGTCACACGTCTGCCGGCCTTGACCAAGCTG
GAGTTCGCCGATGGGCGGCCATTCGTCGACGGCGATACCCAGGCCTGGCTGAGCGGTGCCGAAGCGGGAA
CGGGTACGGCTGTAGCGGGGGCCGGCCTGGAGTATCCGGTTCTGCGCGACGAGTTACGCGCTCAGCTCGA
ATCCGGCGGTGTGGAGTCGATGCTCCGAGGCTTGGAGTCGCTCCAGCAGAGAACGACCGATTTGAGACAT
GCCTGCCACGTCATGGCCATCGCCGCCGAATTGCTCGCCTCTCGTGGGCTGAGCTGGCTCGCCGAAGGCT
TGTTTGCCCGAGCGCACGGTGTCATGGACGGCGCCTCGGCGCGCGCGTGGGAGCCGGAGCTCTACGCACT
CTTGGCGCAGCACGCGTCGGCAGTTGCAGAACGCAAGGATTAA