SecReT6
Protein ID: 564954410
SecReT6 ID880
T6SS typei1
Gene symbol-
Locus tagU769_22680
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]4864004..4866571 [-]
ProductATPase AAA
NoteTssH
UniProt IDV5T3K3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.00E-36, Aligned region: 222..239
AAA_2 [PF07724], Evalue: 3.00E-36, Aligned region: 596..754
AAA [PF00004], Evalue: 9.70E-20, Aligned region: 221..352
AAA [PF00004], Evalue: 9.70E-20, Aligned region: 601..728
AAA_5 [PF07728], Evalue: 4.40E-13, Aligned region: 221..244
AAA_5 [PF07728], Evalue: 4.40E-13, Aligned region: 600..718
ClpB_D2-small [PF10431], Evalue: 6.60E-13, Aligned region: 760..838
AAA_16 [PF13191], Evalue: 5.70E-12, Aligned region: 13..71
AAA_16 [PF13191], Evalue: 5.70E-12, Aligned region: 198..241
AAA_16 [PF13191], Evalue: 5.70E-12, Aligned region: 262..299
AAA_16 [PF13191], Evalue: 5.70E-12, Aligned region: 479..479
AAA_16 [PF13191], Evalue: 5.70E-12, Aligned region: 580..639
AAA_16 [PF13191], Evalue: 5.70E-12, Aligned region: 667..693
AAA_16 [PF13191], Evalue: 5.70E-12, Aligned region: 755..798
AAA_22 [PF13401], Evalue: 7.80E-08, Aligned region: 220..306
AAA_22 [PF13401], Evalue: 7.80E-08, Aligned region: 469..497
AAA_22 [PF13401], Evalue: 7.80E-08, Aligned region: 599..622
AAA_22 [PF13401], Evalue: 7.80E-08, Aligned region: 772..798
AAA_25 [PF13481], Evalue: 6.90E-07, Aligned region: 221..245
AAA_25 [PF13481], Evalue: 6.90E-07, Aligned region: 277..308
AAA_25 [PF13481], Evalue: 6.90E-07, Aligned region: 596..632
AAA_25 [PF13481], Evalue: 6.90E-07, Aligned region: 732..796
Sigma54_activat [PF00158], Evalue: 0.00015, Aligned region: 220..236
Sigma54_activat [PF00158], Evalue: 0.00015, Aligned region: 599..699
NACHT [PF05729], Evalue: 0.00026, Aligned region: 221..248
NACHT [PF05729], Evalue: 0.00026, Aligned region: 601..627
NACHT [PF05729], Evalue: 0.00026, Aligned region: 776..840
IstB_IS21 [PF01695], Evalue: 0.00031, Aligned region: 215..246
IstB_IS21 [PF01695], Evalue: 0.00031, Aligned region: 600..618
AAA_29 [PF13555], Evalue: 0.0015, Aligned region: 216..237
AAA_29 [PF13555], Evalue: 0.0015, Aligned region: 598..611
Clp_N [PF02861], Evalue: 0.002, Aligned region: 34..71
AAA_17 [PF13207], Evalue: 0.0029, Aligned region: 221..240
AAA_17 [PF13207], Evalue: 0.0029, Aligned region: 601..635
DUF815 [PF05673], Evalue: 0.0048, Aligned region: 215..265
DUF815 [PF05673], Evalue: 0.0048, Aligned region: 595..621
DUF258 [PF03193], Evalue: 0.0055, Aligned region: 196..238
DUF258 [PF03193], Evalue: 0.0055, Aligned region: 600..611
Arch_ATPase [PF01637], Evalue: 0.006, Aligned region: 201..234
Arch_ATPase [PF01637], Evalue: 0.006, Aligned region: 273..304
Arch_ATPase [PF01637], Evalue: 0.006, Aligned region: 601..612
Arch_ATPase [PF01637], Evalue: 0.006, Aligned region: 668..682
Protein Sequence: 855 a.a.     [Download]
>gi|564954410|ref|YP_008886980.1| ATPase AAA [Pseudomonas aeruginosa MTB-1]
MITVDLAALFERLSPFCRQAMEEAGSLCIGQRGAEVTVAHLLTAFLEQPACDVRVTLADAGLSVDAVRHA
LSSAFADRDAGNSQYPSLSPLLVEVLQEAWLLSSVELGQPHIRSGAILLATLLNPARYLPLAAIQLFDGV
NREALRKRFSVLLSASAEALEASTDSEASADKLGEDSALARFGHDFTAQARDGRIDPVLCRDAEIDLMVD
ILSRRRKNNPIVVGDAGVGKSAVVEGLALRIVQGRVPAPLRMVELWGLDLGALQAGASVKGEFEKRLKAV
IDEVKGSSRPIILFIDEAHTLIGAGNTAGGSDAANLLKPALARGELRTIAATTWSEYKKYFEKDPALTRR
FQLVKLEEPTPEQAVHILRGLRPIYEASHQVFIGDDALQASATLAGRYLSGRQLPDKAIDVLDTACARVA
SALAEPPRRLSAMENELNQIDAESAQVARDGRAGRAVAPGRLEALATARKDIEQSVVELRQAWERQKALV
DEIVALRARDDVEGLSQVLAGKVAQLSELQRAGALLHADVGAEQIAQVIADWTGIPATTISSDQMARLDS
LPGNLKGRVKGQDAALDVVYRRLLTALADLRRPGTPMGAFLLVGPSGVGKTETALAVADSLFGGEQFLTT
INMSEYQEKFTVSRLLGAPPGYVGYGEGGVLTEAIRKQPYSVVLLDEVEKAHPEVLNVFYQAFDKGELAD
GEGRRIDCQNVLFFLTSNLGFDEGDNSLTDLDGDALRQRLMRFFKPALLARMQIVPYRYLDEEVLNEIID
SRLQRLRQQFRQRYDATLVVVDAARDELRARCARHQNGARMLDASIDGELLPPLSLAVLQRLSRGDKIQR
AQVGWCDGKFAATLD
 
Nucleotide Sequence: 2568 bp     [Download]
>gi|564949884|ref|NC_023019.1|:c4866571-4864004 Pseudomonas aeruginosa MTB-1, complete genome
ATGATCACGGTTGATCTAGCAGCACTATTCGAACGCTTGAGCCCCTTCTGCCGGCAGGCGATGGAGGAAG
CGGGAAGCCTATGCATTGGCCAGCGCGGTGCGGAGGTGACCGTTGCGCATCTGCTCACGGCGTTCCTCGA
ACAGCCCGCTTGCGATGTCCGCGTCACCCTGGCCGACGCGGGCCTCTCCGTAGATGCGGTTCGGCATGCC
CTGTCCAGCGCCTTCGCCGACCGCGACGCGGGCAACAGTCAGTACCCGTCCCTCTCGCCGCTGCTCGTCG
AGGTGCTGCAAGAGGCTTGGCTGCTCAGTTCGGTGGAGCTGGGGCAGCCACATATCCGCAGCGGCGCGAT
CCTCCTCGCGACCTTGCTCAACCCGGCACGCTACCTGCCCTTGGCGGCCATCCAGTTGTTCGATGGCGTC
AATCGGGAAGCGTTGCGAAAGCGCTTCTCGGTTCTGCTGTCGGCGTCAGCGGAAGCGCTAGAGGCGTCAA
CCGACTCGGAGGCCTCGGCGGACAAGCTTGGTGAAGACAGTGCCCTGGCCAGGTTCGGCCATGACTTCAC
TGCGCAGGCGCGCGACGGGCGAATAGATCCCGTGCTGTGCCGCGATGCGGAGATCGACCTGATGGTCGAC
ATCCTCTCTCGCCGGCGCAAGAACAATCCCATCGTCGTGGGCGACGCCGGCGTCGGTAAAAGCGCGGTGG
TCGAGGGCCTGGCCCTGCGCATCGTGCAGGGCCGAGTGCCTGCCCCCCTGCGCATGGTCGAGCTGTGGGG
GCTGGACCTAGGCGCACTGCAAGCTGGAGCGTCGGTGAAAGGCGAATTCGAGAAGCGCTTGAAGGCGGTG
ATCGATGAGGTCAAGGGCTCCTCCCGACCGATCATTCTGTTCATCGATGAGGCCCATACCCTGATAGGCG
CCGGTAATACCGCTGGCGGCAGCGATGCCGCCAATCTGCTCAAGCCGGCATTGGCTCGCGGCGAGCTACG
CACCATCGCTGCGACGACGTGGTCCGAGTACAAGAAGTACTTCGAGAAAGATCCGGCCCTGACGCGTCGC
TTCCAACTCGTCAAGCTGGAGGAGCCCACGCCGGAGCAAGCCGTGCACATTCTGCGCGGCCTGCGACCGA
TCTATGAGGCATCGCATCAGGTGTTCATCGGTGACGACGCGCTGCAGGCCTCCGCAACGCTGGCGGGGCG
ATACCTGTCGGGGCGGCAACTGCCGGATAAGGCCATCGATGTGCTCGATACTGCCTGCGCGCGGGTGGCA
TCCGCGCTGGCTGAGCCACCGCGGCGCCTGAGCGCGATGGAGAACGAGCTCAACCAGATCGACGCTGAAT
CTGCCCAGGTGGCACGTGACGGCCGTGCCGGGCGCGCGGTCGCTCCAGGCCGCCTTGAAGCGCTGGCCAC
GGCCCGCAAAGACATAGAACAGAGCGTCGTGGAGCTGCGTCAGGCCTGGGAGCGGCAGAAGGCGCTGGTC
GATGAGATCGTTGCGCTGAGGGCCCGCGATGATGTTGAAGGTCTATCGCAGGTACTGGCCGGCAAGGTCG
CTCAACTGAGTGAACTCCAGCGGGCAGGCGCCCTGTTGCATGCGGACGTGGGCGCGGAGCAGATCGCCCA
GGTGATTGCCGACTGGACGGGCATCCCTGCCACCACCATCAGCAGCGACCAGATGGCGCGGCTGGACAGT
CTGCCCGGGAATCTCAAAGGGCGGGTCAAAGGCCAGGATGCTGCCCTGGACGTCGTGTACCGGCGCCTGC
TCACCGCATTGGCGGACCTGCGCCGCCCGGGCACGCCGATGGGCGCGTTCCTGCTGGTCGGCCCCAGCGG
CGTCGGCAAGACCGAGACGGCTTTGGCGGTGGCTGACTCGCTCTTCGGCGGTGAGCAATTCCTCACGACC
ATCAACATGTCGGAGTACCAGGAGAAGTTCACCGTGTCCCGCCTTCTGGGTGCGCCGCCCGGCTACGTTG
GCTATGGCGAGGGCGGCGTGCTGACCGAGGCCATCCGCAAGCAGCCGTACTCCGTGGTATTGCTCGACGA
AGTGGAAAAAGCCCATCCAGAAGTTCTGAACGTGTTCTACCAAGCCTTCGACAAAGGCGAGCTGGCTGAC
GGCGAAGGCCGTCGCATTGACTGCCAGAACGTGCTGTTCTTCCTGACCTCGAACCTGGGCTTCGACGAAG
GCGACAACTCGCTGACCGACCTGGACGGCGATGCGTTGCGCCAGCGGCTCATGCGCTTCTTCAAGCCGGC
GCTTCTGGCTCGGATGCAGATCGTCCCGTATCGCTACCTGGACGAGGAGGTGCTCAACGAGATCATCGAC
AGCCGGCTGCAGCGGTTGCGGCAGCAGTTCCGGCAGCGCTACGACGCCACTTTGGTGGTGGTTGATGCGG
CGCGGGACGAGCTGCGGGCGCGCTGCGCACGGCATCAGAATGGGGCGCGCATGCTCGACGCGAGTATCGA
TGGCGAGCTGCTGCCTCCGCTGTCATTGGCCGTGCTGCAGCGCTTGTCCCGCGGAGACAAGATTCAGCGT
GCGCAGGTGGGTTGGTGCGATGGCAAGTTCGCTGCAACGCTGGATTGA