SecReT6
Protein ID: 564954411
SecReT6 ID880
T6SS typei1
Gene symbol-
Locus tagU769_22685
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]4867057..4867560 [+]
Producthypothetical protein
NoteTssB
UniProt IDV5T312
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.80E-57, Aligned region: 6..160
Protein Sequence: 167 a.a.     [Download]
>gi|564954411|ref|YP_008886981.1| hypothetical protein U769_22685 [Pseudomonas aeruginosa MTB-1]
MAKKNGSVAPKERINITYVPATNGEQEEVELPLRLLVTGDFLGREEETALEDRIPVRINKDNFNNVMAEM
KLGLKENIPNVLSEGADDTLHVDLKFRSIDDFSPDAIARQIPELNKLLELREALVALKGPLGNVPAFRKQ
LQTMLGDESARNKLARELEAVLGESVS
 
Nucleotide Sequence: 504 bp     [Download]
>gi|564949884|ref|NC_023019.1|:4867057-4867560 Pseudomonas aeruginosa MTB-1, complete genome
ATGGCAAAAAAGAATGGATCGGTTGCCCCAAAGGAGCGCATCAATATCACCTACGTTCCAGCAACGAATG
GCGAACAAGAGGAAGTCGAACTCCCCTTGCGACTGCTGGTGACGGGTGATTTCCTGGGGCGCGAAGAAGA
AACCGCGCTCGAAGACCGCATTCCGGTGCGCATCAACAAGGACAACTTCAACAACGTCATGGCCGAGATG
AAACTTGGCCTGAAGGAAAACATTCCCAACGTACTTTCCGAGGGAGCAGACGACACCCTGCATGTCGACC
TCAAGTTCCGCTCCATCGACGACTTCAGCCCTGATGCCATCGCCCGCCAGATTCCAGAGTTGAACAAGCT
ACTCGAACTGCGCGAGGCACTGGTCGCCCTCAAGGGGCCGCTGGGCAACGTCCCGGCGTTCCGCAAGCAG
CTGCAAACCATGCTTGGCGACGAGAGCGCACGCAACAAGCTCGCCAGGGAACTGGAAGCGGTGCTGGGTG
AAAGCGTGAGCTGA