SecReT6
Protein ID: 564954412
SecReT6 ID880
T6SS typei1
Gene symbol-
Locus tagU769_22690
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]4867748..4869229 [+]
Producttype VI secretion protein
NoteTssC
UniProt IDV5T1B2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-177, Aligned region: 66..491
Protein Sequence: 493 a.a.     [Download]
>gi|564954412|ref|YP_008886982.1| type VI secretion protein [Pseudomonas aeruginosa MTB-1]
MTRAQSAAVEKQDSLPEGGLLAQILAQTRMEPSQEGYAVAERGVAAFIAEMLKSPDRQQPVNKQLVDQML
AQIDAKLSKQTDVILHNRKLQAVEAIWRSLKFLTDRTDFRENTIIDLLPVTKAELLEDFESASDITRSGL
YKHVYTAGYGQFGGQPVGYMVSNYTFGPSAPDIKLLGYVASLGAMAHAPFLGAAGPEMLNLESFQDLPNL
KEVKDIFEGPRFTKWRGLRDAEDARYLGLTMPRFLLRQPYDPLENPVRGFDYRETIDGNHDNYLWGNSSF
ALASRIVDSFAKYRWCPNIIGPQSGGTVDDLPVHLYESLGQLQAKIPTEVLVSDRREFELSSAGFIPLTM
RKDSDNAAFFSANSIQRPKVFAKTPEGQAAQTNYMLGTQLPYMTIINRLAHYLKVLQREQIGSWKERPDL
ERELNNWIRQYVADQESPSSDVRSRRPLRAAKVTVQDVEGNPGWYQVSLSVRPHFKYMGANFELSLVGRL
DKE
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|564949884|ref|NC_023019.1|:4867748-4869229 Pseudomonas aeruginosa MTB-1, complete genome
ATGACAAGAGCGCAATCCGCCGCTGTCGAAAAGCAAGACTCCCTACCCGAAGGCGGCCTGCTGGCCCAGA
TCCTCGCGCAGACGCGCATGGAGCCCAGCCAGGAAGGCTATGCCGTCGCAGAGCGAGGCGTGGCCGCCTT
CATCGCCGAAATGCTCAAGTCGCCGGATCGCCAGCAGCCGGTCAACAAGCAACTGGTCGACCAGATGCTG
GCGCAGATCGACGCCAAGCTCAGCAAGCAGACGGATGTCATTCTGCACAACCGAAAGCTCCAGGCAGTGG
AGGCCATTTGGCGTTCACTCAAGTTCCTGACCGACCGCACCGATTTCCGCGAAAACACCATCATCGATCT
GCTGCCTGTGACGAAAGCGGAGCTCCTGGAGGATTTTGAGAGCGCCAGCGACATCACCCGTAGCGGCTTG
TACAAGCACGTCTACACCGCGGGCTACGGCCAGTTTGGCGGTCAGCCGGTGGGTTACATGGTCAGCAACT
ACACCTTCGGTCCTTCAGCTCCGGACATCAAGCTGCTCGGCTACGTCGCATCGCTCGGGGCAATGGCACA
CGCGCCGTTCCTGGGCGCAGCAGGTCCTGAAATGCTGAACCTGGAGTCCTTCCAAGACCTGCCGAACCTC
AAGGAGGTGAAGGACATCTTCGAGGGGCCGCGCTTCACCAAGTGGCGAGGCCTGCGGGATGCGGAAGACG
CCCGCTACCTGGGTCTGACCATGCCGCGCTTCCTGCTGCGTCAGCCCTATGACCCTCTCGAAAACCCGGT
CCGCGGTTTCGACTATCGCGAGACTATCGACGGCAATCACGACAACTATCTCTGGGGCAACTCCTCGTTC
GCGCTGGCCAGCCGGATCGTCGACAGCTTCGCCAAGTACCGCTGGTGCCCGAACATCATCGGCCCGCAGT
CTGGCGGCACCGTCGACGACCTGCCGGTCCACCTGTACGAGTCTCTCGGCCAGCTTCAGGCCAAGATCCC
CACCGAGGTGCTCGTCTCTGACCGGCGGGAGTTCGAGCTGTCCAGCGCGGGCTTCATTCCGCTGACCATG
CGCAAGGACAGCGACAACGCTGCCTTCTTCTCCGCCAACTCGATTCAGCGGCCCAAGGTCTTTGCAAAGA
CGCCGGAAGGTCAGGCCGCACAGACGAACTACATGCTCGGCACGCAGTTGCCCTACATGACGATCATCAA
CCGTCTGGCCCACTACCTGAAGGTACTGCAGCGCGAACAAATCGGTAGCTGGAAGGAGCGCCCGGACTTG
GAGCGCGAACTCAACAACTGGATCCGCCAGTACGTCGCAGACCAGGAAAGCCCGTCCTCCGATGTGCGCA
GCCGCAGGCCACTGCGCGCCGCCAAGGTCACGGTGCAGGACGTCGAGGGCAATCCGGGCTGGTATCAGGT
TTCGCTGTCGGTCCGTCCGCACTTCAAGTACATGGGCGCCAACTTCGAGCTTTCGCTCGTCGGCCGCCTC
GACAAGGAGTGA