SecReT6
Protein ID: 564954413
SecReT6 ID880
T6SS typei1
Gene symbol-
Locus tagU769_22695
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]4869238..4869666 [+]
Producthypothetical protein
NoteTssE
UniProt IDV5T233
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.20E-20, Aligned region: 31..124
Protein Sequence: 142 a.a.     [Download]
>gi|564954413|ref|YP_008886983.1| hypothetical protein U769_22695 [Pseudomonas aeruginosa MTB-1]
MPRSPGQGSLFERLTPDLPPRRSRTQQGLATERVRAIKNHLEQLLNTRRGGSQSSPELGLPDMNDAASGQ
LELRNQICQEIREVVALYEPRVQVLDVRALTTSEQPLGLCFRLHCQVPIKDASEQMEIDLLVHQRQQRIQ
VM
 
Nucleotide Sequence: 429 bp     [Download]
>gi|564949884|ref|NC_023019.1|:4869238-4869666 Pseudomonas aeruginosa MTB-1, complete genome
ATGCCGCGGTCGCCAGGACAGGGAAGCTTGTTCGAACGGCTCACCCCGGATCTGCCGCCGCGGCGTTCGC
GCACGCAGCAGGGCCTGGCGACCGAGCGCGTTCGAGCCATCAAGAACCATCTGGAACAGTTGCTCAACAC
CCGTCGGGGCGGCTCGCAGAGCAGCCCCGAGCTGGGGCTGCCCGACATGAACGATGCCGCGTCGGGTCAA
TTGGAATTGAGAAACCAGATCTGCCAGGAAATCCGAGAAGTAGTGGCCCTCTACGAGCCTCGGGTCCAGG
TCCTGGACGTCCGCGCGCTCACGACCAGCGAGCAGCCACTGGGTCTGTGCTTCCGGCTGCATTGTCAGGT
TCCAATCAAGGATGCCTCCGAGCAGATGGAGATAGACCTGCTGGTTCACCAGCGGCAACAACGGATCCAG
GTGATGTGA