SecReT6
Protein ID: 564954414
SecReT6 ID880
T6SS typei1
Gene symbol-
Locus tagU769_22700
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]4869688..4871454 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDV5T1V0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.00E-189, Aligned region: 5..588
Protein Sequence: 588 a.a.     [Download]
>gi|564954414|ref|YP_008886984.1| type VI secretion protein [Pseudomonas aeruginosa MTB-1]
MPLKSKFREELDYLRRLGRVFARNNPQLARFLGDEATDPDVERLLEGFAFLTAKLRLKIEDDFPELTHPL
LQLLWPNYLRPLPSATIMQFPPVDRAITVRQRIPKGTRIRSRNVDGVECEYRTCSDVEIYPLQIGEVSDA
HTLEKSTVRVDLATLSKNPPSTYDCDRLDFYLSGSDYTAMTLYLWLSKYLADVRMECDGVVRHIPASQIL
FPGFNPDDALLPYPKNALDGYRILQEYFLFPRRYFFFGIAGLRALWPSHSTERIRLEFNFTRPMPDDVRV
HTGDLALYCAPAVNLFEHEAEPVRLTGKTVDYRLRPAGQRPDAYEIFSIDRVDGWKNEASGQPGAWLRTY
QPFESLRHQIDFEQGKTVLYYRTRIDPSLVNSGVEHRVSFVRSDEQRYVGREETVSFSLTCTNRDLPLTL
AVGDICVRTPGMPNFVSCRNLTTPTPSYRPVLDGNLQWTLISNLSPTYLSLLSAAPLKAVIRAYDFAAHH
DIQRARATQMRLDGLLEVETTPVDRMFKALPIRGVRTVVKLDQDGFSCEGDLYLFGTVLSHFLSVYASIS
SFHVLEAINVKNQEHYAWPIRSGTQPLI
 
Nucleotide Sequence: 1767 bp     [Download]
>gi|564949884|ref|NC_023019.1|:4869688-4871454 Pseudomonas aeruginosa MTB-1, complete genome
ATGCCACTGAAGAGCAAGTTCCGGGAAGAACTGGATTACCTGCGCCGTCTCGGCCGAGTGTTCGCACGTA
ACAATCCGCAGCTGGCAAGGTTCCTCGGTGACGAGGCCACTGACCCCGACGTTGAACGGCTGTTGGAAGG
CTTCGCCTTCCTGACGGCCAAGCTGCGCCTGAAAATCGAAGATGATTTCCCCGAGCTGACGCATCCGCTG
CTACAACTGCTGTGGCCCAACTACCTGCGGCCGCTGCCCAGCGCCACCATCATGCAGTTTCCGCCTGTGG
ACCGCGCCATCACCGTCCGCCAGCGCATCCCGAAAGGAACACGCATCCGCTCGCGCAACGTCGACGGCGT
GGAGTGCGAGTACCGCACCTGCTCAGACGTCGAGATCTACCCGTTGCAGATCGGCGAAGTCAGCGATGCG
CATACGCTGGAGAAATCTACGGTCCGCGTGGACCTCGCCACATTGAGCAAGAACCCGCCAAGCACCTACG
ACTGCGACCGGCTGGATTTCTACTTGAGCGGCAGTGACTACACCGCCATGACGCTGTACCTGTGGCTCTC
CAAGTACCTGGCCGACGTTCGCATGGAGTGCGACGGTGTGGTCAGGCACATTCCCGCCAGCCAGATCCTC
TTCCCGGGATTCAACCCGGACGACGCATTGCTGCCTTACCCGAAAAACGCCCTGGACGGCTACCGCATCC
TGCAGGAGTACTTCCTTTTCCCGCGGCGGTACTTTTTCTTCGGCATTGCCGGACTGCGCGCCCTCTGGCC
GAGCCACAGCACGGAACGCATCCGGCTGGAATTCAACTTCACCCGCCCCATGCCTGACGACGTGCGCGTG
CACACAGGTGACCTGGCGCTGTACTGCGCACCTGCGGTCAATCTCTTCGAGCATGAGGCTGAGCCAGTGA
GGTTGACCGGCAAGACGGTCGACTATCGCCTCCGGCCAGCAGGCCAGCGGCCCGATGCGTACGAGATTTT
CAGCATCGATCGCGTCGACGGTTGGAAGAACGAGGCCTCCGGCCAGCCAGGAGCCTGGCTGCGCACCTAC
CAACCGTTCGAGTCGCTTCGCCACCAGATCGACTTCGAGCAGGGCAAGACCGTCCTCTACTACCGCACCC
GTATTGACCCATCACTGGTGAACTCAGGCGTCGAGCATCGAGTGTCCTTCGTGCGCAGCGACGAACAGCG
CTACGTCGGGCGTGAGGAAACCGTCTCCTTCTCGCTCACTTGCACCAACCGTGACCTGCCGCTGACGTTG
GCGGTGGGCGACATCTGCGTGCGCACGCCAGGCATGCCGAACTTCGTGTCCTGCCGCAACCTGACCACCC
CGACACCTTCTTACCGACCGGTGCTGGACGGCAACTTGCAGTGGACCCTGATATCCAACCTGTCGCCCAC
CTACCTGTCCCTGCTGTCGGCCGCCCCCTTGAAAGCCGTCATCCGTGCCTACGACTTCGCTGCTCACCAT
GACATCCAGCGCGCACGCGCCACGCAGATGCGCCTGGACGGCCTTCTGGAGGTGGAGACTACGCCCGTCG
ATCGCATGTTCAAGGCGCTGCCCATCCGCGGCGTGCGCACCGTGGTCAAGCTCGACCAGGACGGATTCTC
CTGCGAGGGAGACCTGTACCTCTTCGGCACGGTGCTGAGCCACTTCCTGTCCGTGTACGCCAGCATCTCG
TCGTTCCATGTGCTGGAAGCCATCAACGTCAAGAATCAGGAGCACTACGCATGGCCGATACGCAGCGGCA
CGCAGCCCCTGATCTGA