SecReT6
Protein ID: 564954415
SecReT6 ID880
T6SS typei1
Gene symbol-
Locus tagU769_22705
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]4871418..4872437 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDV5T3L7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.00E-83, Aligned region: 18..323
Protein Sequence: 339 a.a.     [Download]
>gi|564954415|ref|YP_008886985.1| type VI secretion protein [Pseudomonas aeruginosa MTB-1]
MADTQRHAAPDLNDRLLDEARGHNFFCLLERLHGLHGDDLESEEPYAAERQRIRLSNYAGMGFPASDVSL
AQRLDGDLPHQYLVQATFFGMHGPDSPLPSYYLERLAYEAGQGEGIRPAFLDFFNHRLLTLLHQAWRKYR
HYIRFRPGASDLLSQRLFALVGLKDDAIRGATPIAWSRLLSFAGAVVHRSRSPAMVAGLIAHCFDLPDVA
IRDFELRYTDIAPDDRAQLGRRNGQLGESFRIGDSVRTRHCKFTIVITNLSETRFREFLPQGENFERLRM
LVAYLLRDQTPCDLELGLRENEVPPFNLGQVTGSHLGWTSFLEQPELRRPPRVRLTVRT
 
Nucleotide Sequence: 1020 bp     [Download]
>gi|564949884|ref|NC_023019.1|:4871418-4872437 Pseudomonas aeruginosa MTB-1, complete genome
ATGGCCGATACGCAGCGGCACGCAGCCCCTGATCTGAACGACCGCTTGCTCGACGAGGCCAGGGGGCACA
ACTTCTTCTGCCTGCTCGAACGCCTGCACGGGCTCCATGGCGACGACCTGGAATCCGAAGAGCCCTATGC
CGCCGAGCGGCAGCGCATCCGCCTGAGCAACTACGCCGGCATGGGCTTTCCTGCCTCGGACGTATCGCTG
GCGCAGCGTCTCGATGGTGATCTCCCACACCAGTACCTGGTGCAGGCAACCTTCTTCGGCATGCACGGTC
CCGATTCGCCGCTGCCGTCCTACTACTTGGAACGTCTTGCCTACGAGGCAGGGCAAGGCGAGGGCATTCG
TCCGGCATTCCTCGACTTCTTCAACCATCGTCTGCTGACCCTGCTGCACCAGGCTTGGCGCAAGTACCGC
CACTACATCCGGTTCCGCCCAGGAGCGAGCGACCTTCTGTCCCAGCGCCTCTTCGCCCTGGTGGGACTCA
AGGACGATGCCATCCGCGGCGCCACGCCCATTGCCTGGAGCCGACTGCTCAGCTTCGCCGGTGCCGTGGT
TCACCGCAGCCGCTCCCCCGCCATGGTGGCAGGCCTGATCGCCCACTGCTTCGACCTGCCGGACGTCGCC
ATCCGCGATTTCGAGTTGCGCTACACCGACATCGCCCCGGACGACCGCGCTCAATTGGGGCGCCGAAACG
GCCAGTTGGGCGAGAGCTTCCGCATCGGCGACAGCGTCAGAACGCGCCACTGCAAATTCACCATCGTCAT
CACCAACCTATCGGAGACGCGCTTTCGCGAGTTTCTGCCCCAGGGCGAGAACTTCGAGCGGCTTCGTATG
CTGGTCGCCTACCTGCTGCGCGACCAGACCCCTTGCGATCTTGAACTGGGACTGCGCGAGAACGAGGTCC
CCCCCTTCAACCTCGGGCAGGTCACCGGCTCCCATCTGGGCTGGACCAGCTTCCTTGAGCAGCCGGAACT
GCGCAGACCTCCCCGCGTTCGACTCACGGTACGCACATGA