SecReT6
Protein ID: 564954416
SecReT6 ID880
T6SS typei1
Gene symbol-
Locus tagU769_22710
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]4872434..4873798 [+]
Producthypothetical protein
NoteFha
UniProt IDV5T330
KEGG IDpaem:U769_22710
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 7.10E-07, Aligned region: 36..102
Protein Sequence: 454 a.a.     [Download]
>gi|564954416|ref|YP_008886986.1| hypothetical protein U769_22710 [Pseudomonas aeruginosa MTB-1]
MTTANSEFRLSLVVENPQALQQGSMPGHSFGSDGGTIGSQGANWILLDRGGRVRPQHCEIRLEDGGFLII
DRSGETVVNDQTQPLGLNASARLRNGDKLHVGPYRIGVHLDNELHYLPDPTRALAEHDLSEFTQPPTDYL
DALPDSAPDAPDAGHQQQPGWAEFQALAEPPPPQGLLDPLKALDATRGGAARTDTEVSSLDPRHYGHTPL
AAQADVTTTQFEAVYGTPIHAPGGSRMLEQDIQTPVAREWLQSLLSSSADPTSLVEPLVEGIGAPVGTVD
GQETYALLNEVGRTLGALIRGLSALNASQPGDQQRVSLAGRTLQPIEDNPLRLGQSYPETVRALFSAKRS
VVHLSPSAAVEESLEQMRRQQVAMHKAITAGLGALLQAFSPEQLQQRFQRYRSAQTGHPQADDWAWRMYG
HYYDELISGRQRGFEKLFWEVFEQAFDQALRAEA
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|564949884|ref|NC_023019.1|:4872434-4873798 Pseudomonas aeruginosa MTB-1, complete genome
ATGACTACAGCAAACTCAGAATTTCGCCTGTCTCTGGTCGTGGAGAACCCCCAAGCGCTCCAGCAAGGCA
GCATGCCAGGGCATAGCTTCGGTTCCGATGGCGGCACCATCGGTTCGCAGGGGGCCAACTGGATCCTGCT
CGACCGCGGAGGCCGCGTGCGGCCGCAACATTGTGAAATCCGCTTGGAGGACGGCGGATTCCTCATCATC
GACCGCAGTGGCGAAACCGTCGTCAACGACCAGACACAGCCGCTTGGCCTCAATGCCAGCGCCAGGTTGA
GAAACGGGGACAAGCTTCACGTCGGCCCATACCGCATCGGTGTTCACCTGGACAACGAGCTTCACTACCT
ACCCGATCCCACCCGCGCTCTGGCCGAGCACGACCTTAGCGAGTTCACCCAACCGCCCACGGACTACCTG
GATGCGCTGCCGGACTCTGCGCCGGATGCTCCCGATGCGGGGCACCAGCAACAGCCTGGCTGGGCTGAAT
TCCAGGCGCTGGCCGAGCCACCGCCGCCACAGGGCCTGCTAGACCCGCTCAAGGCGCTCGACGCCACCCG
AGGCGGAGCAGCTCGGACAGACACCGAGGTGTCCAGCCTCGACCCTCGCCACTACGGACACACGCCGCTG
GCCGCCCAGGCAGACGTCACCACGACCCAATTCGAAGCCGTCTACGGCACGCCCATTCACGCCCCAGGAG
GATCTCGCATGTTGGAACAGGACATCCAGACACCCGTTGCCCGAGAATGGCTACAAAGCCTGCTCTCCAG
CAGCGCAGACCCCACTAGCCTGGTTGAGCCTCTGGTTGAAGGTATCGGAGCGCCGGTCGGGACCGTCGAC
GGGCAGGAAACCTATGCACTGTTGAATGAGGTCGGACGCACGCTCGGTGCGCTGATACGAGGCCTGTCCG
CTCTGAACGCCAGCCAGCCTGGCGATCAGCAGCGGGTTTCCCTGGCCGGGCGCACGCTGCAGCCCATCGA
GGACAACCCTCTGCGCCTGGGGCAGAGCTATCCGGAAACCGTGCGCGCTCTGTTCTCCGCCAAGCGCAGC
GTCGTCCATCTGTCGCCCTCGGCGGCGGTGGAGGAATCGCTGGAGCAGATGCGCAGGCAGCAGGTCGCCA
TGCACAAGGCCATCACCGCCGGCCTCGGTGCGCTCCTGCAGGCATTCTCGCCCGAACAGCTTCAGCAGAG
ATTCCAGCGCTATCGCAGTGCGCAGACCGGCCACCCGCAAGCAGACGACTGGGCCTGGCGCATGTACGGG
CACTACTACGATGAGCTAATTTCCGGCCGACAGCGAGGCTTCGAAAAGCTGTTCTGGGAAGTCTTCGAGC
AGGCGTTCGACCAGGCCCTGCGCGCGGAGGCGTAA