SecReT6
Protein ID: 564954417
SecReT6 ID880
T6SS typei1
Gene symbol-
Locus tagU769_22715
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]4873798..4874817 [+]
Producthypothetical protein
NoteTssJ
UniProt IDV5T1D1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.60E-32, Aligned region: 12..68
T6SS-SciN [PF12790], Evalue: 7.60E-32, Aligned region: 213..313
Protein Sequence: 339 a.a.     [Download]
>gi|564954417|ref|YP_008886987.1| hypothetical protein U769_22715 [Pseudomonas aeruginosa MTB-1]
MKHAIALLCAATLLAGCSTVGDVFKKTGQILMDPSIQVGTAEEQPTQIALSLYASADVNPNPVSRPTAAP
VEDVEPLPLDVEDDGPFAVSLRSANKGELVEHLRALLGHLENDQTGSPSALAVQQRSAIPGLVVDEQAPP
LTLGKTLPETLFTSTATSRGPFPANWMLRQGQAKPVTEQDHGNASMHKLDLGQYSRGAGLAQAGDARATP
ITATPIAFRVMQLKDDSMLENVNPELLRIDPKKALGSTLLAADDYTLAPGQFKFIEFTAIDEKTRYIAVV
ADFHDPNAERWHDVFRIEPRGRKYPLMVMLQTTRVAITDESYRPAQGNFCPAPQASTYQ
 
Nucleotide Sequence: 1020 bp     [Download]
>gi|564949884|ref|NC_023019.1|:4873798-4874817 Pseudomonas aeruginosa MTB-1, complete genome
ATGAAGCACGCCATCGCGCTCCTGTGCGCCGCGACACTGCTTGCCGGCTGCAGCACCGTGGGCGACGTGT
TCAAGAAAACGGGCCAGATCCTGATGGACCCATCCATTCAGGTTGGGACCGCAGAAGAGCAGCCCACGCA
GATCGCCCTGAGCTTGTACGCCAGCGCGGACGTCAATCCCAATCCGGTCAGCCGCCCGACCGCCGCGCCA
GTCGAGGACGTCGAGCCACTGCCATTGGACGTGGAAGACGACGGCCCCTTCGCGGTCAGCCTGCGCAGCG
CAAACAAGGGCGAGCTCGTCGAGCATCTGCGTGCGCTACTCGGCCATCTGGAGAATGACCAGACAGGTTC
ACCCAGCGCGCTCGCCGTTCAACAGCGCTCGGCCATTCCCGGCCTGGTTGTTGACGAGCAGGCGCCCCCT
CTGACGTTGGGCAAGACACTGCCGGAAACGCTATTCACCAGCACCGCGACCTCGCGCGGGCCGTTCCCCG
CGAACTGGATGCTGCGCCAGGGACAAGCGAAGCCCGTCACAGAGCAGGACCACGGGAACGCATCCATGCA
CAAACTGGACCTAGGGCAATACAGCCGCGGCGCGGGCTTGGCCCAGGCCGGAGACGCTCGCGCCACGCCG
ATTACGGCCACCCCGATTGCCTTCCGGGTGATGCAGCTCAAGGACGACTCCATGCTGGAGAACGTCAACC
CTGAGCTGCTGCGCATCGACCCCAAGAAGGCGTTGGGCAGCACCCTCCTGGCCGCGGACGACTACACCTT
GGCACCGGGCCAGTTCAAGTTCATCGAGTTCACCGCCATCGACGAGAAGACCCGCTACATCGCCGTGGTG
GCCGACTTCCACGACCCCAATGCCGAACGCTGGCACGACGTCTTCCGCATCGAGCCGCGCGGACGCAAGT
ATCCCCTCATGGTGATGTTGCAGACCACCCGCGTCGCCATCACCGATGAAAGCTACCGGCCCGCGCAGGG
CAATTTCTGCCCAGCCCCCCAAGCGAGTACCTACCAATGA