SecReT6
Protein ID: 564954418
SecReT6 ID880
T6SS typei1
Gene symbol-
Locus tagU769_22720
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]4874814..4876151 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDV5T247
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.50E-136, Aligned region: 19..443
Protein Sequence: 445 a.a.     [Download]
>gi|564954418|ref|YP_008886988.1| type VI secretion protein [Pseudomonas aeruginosa MTB-1]
MTTRNPVVWSEGLFVKPQHFQQTARYLEHYVNSRHGSRYWYGFSELELNQEFLAFGKIAIIRARGVMPDG
TLFDIPHDQPPPEPLAITNAGAANQTVYLTLQLRSDGTAQVRWPDTYGNTRYVVHTEEVRDTHSHQGNHV
PLDLAVPNLQLALERDDRSAFTGLALGRILDLRPDGSLLMDAGFYITGLHLHAIRPLAHFMEEISSLMHE
RAKSIAQRIGSPGQSGVADFTDFNLLQALNRWQHQFRHMARDPDVRPVEAYLACGQACGELATCIDESRL
APEFPAYQHDNPKSTFLMLEETLRRLLGTVLQPRAVSLPLVKQAHGILTAQVNDTSLMDSADFILAVRAR
MPLDQMRHLFLQQAKVASQQSLLELIRLQLPGIPLSPLPVAPRHLPFHAGFTYFQLDRTSVNWQKLMPKG
TNSFGFHISGDYPELQLQFWAIRSQ
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|564949884|ref|NC_023019.1|:4874814-4876151 Pseudomonas aeruginosa MTB-1, complete genome
ATGACCACCCGCAATCCCGTTGTCTGGAGCGAGGGCCTCTTCGTCAAGCCCCAACATTTCCAGCAGACCG
CCAGATACCTGGAGCACTACGTCAACTCCCGCCACGGCAGCCGGTACTGGTACGGTTTCTCCGAGTTGGA
GTTGAATCAGGAATTCCTCGCCTTCGGCAAGATTGCCATCATCCGAGCCCGTGGCGTCATGCCCGACGGT
ACGCTGTTCGACATCCCGCATGACCAACCGCCGCCGGAGCCGCTGGCCATCACGAACGCCGGTGCGGCCA
ATCAGACCGTCTACCTCACGCTGCAGTTGCGCTCCGACGGCACTGCCCAGGTGCGCTGGCCCGACACCTA
CGGCAACACACGCTACGTCGTGCACACGGAGGAAGTGCGCGATACCCACAGTCACCAGGGCAACCACGTC
CCACTGGACCTGGCCGTTCCCAACCTGCAATTAGCGCTGGAGCGCGACGACCGTAGCGCCTTCACCGGCC
TGGCCCTGGGCCGCATCCTCGACCTGCGACCCGACGGCAGCCTGCTGATGGACGCGGGGTTCTACATCAC
CGGCCTGCACCTCCACGCCATCCGCCCGCTGGCGCATTTCATGGAAGAAATCTCCTCCCTAATGCACGAG
CGCGCCAAGAGCATCGCCCAACGCATCGGCTCGCCGGGCCAGTCCGGCGTGGCCGACTTCACCGACTTCA
ATCTCCTGCAGGCCCTCAATCGCTGGCAGCACCAGTTCCGCCACATGGCCCGGGACCCGGACGTGCGCCC
CGTCGAAGCCTACCTGGCGTGTGGACAAGCCTGCGGCGAGCTGGCCACATGCATCGACGAATCACGCCTG
GCCCCCGAGTTCCCCGCCTACCAGCACGACAATCCCAAGAGCACCTTTCTGATGCTGGAGGAAACCCTGC
GCCGCCTCCTCGGCACCGTGCTCCAGCCGCGCGCCGTATCTCTGCCACTGGTCAAGCAGGCGCACGGCAT
CCTCACCGCGCAGGTCAACGACACCAGCCTGATGGACAGCGCCGACTTCATCCTGGCCGTGCGCGCGCGC
ATGCCGCTGGATCAGATGCGCCACCTGTTCCTGCAACAGGCCAAGGTCGCCTCGCAGCAATCGCTGCTGG
AACTCATCCGCCTGCAGCTCCCCGGCATACCGCTCAGCCCACTGCCAGTAGCCCCGAGGCACCTGCCGTT
CCACGCCGGCTTCACCTACTTCCAGCTCGATCGCACCTCGGTCAACTGGCAGAAGCTTATGCCAAAGGGC
ACCAACAGCTTCGGCTTCCACATCAGCGGCGATTACCCCGAGCTGCAGCTGCAGTTCTGGGCCATCCGGA
GTCAATGA