SecReT6
Protein ID: 564954419
SecReT6 ID880
T6SS typei1
Gene symbol-
Locus tagU769_22725
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]4876153..4877052 [+]
Producthypothetical protein
NoteTssL
UniProt IDV5T1W9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.20E-64, Aligned region: 77..282
Protein Sequence: 299 a.a.     [Download]
>gi|564954419|ref|YP_008886989.1| hypothetical protein U769_22725 [Pseudomonas aeruginosa MTB-1]
MNTTIQIGNDRIDRNPPKHGAPDTQVDQPPAAAPQDDFLRTAPNADIRDKGSMLYDSVFRIDQDDDLQFQ
LRGHSLNPLIDAAQPLLGLVIRLRRLDRCDDIPKLYASVRDQITALSEEVRQLGYDGATQLAYRYALCAF
IDEAVMATAWGQASLWRERSLLSYHHNETWGGEKFFTVLARMQMDPTRYRDVLEFKYLCLCLGFQGKYGQ
QHNNRDTLNSIIVKLHRILRVQRGDAPERLTDGTDNVASRRYRLARQWPLWTPWAIAVVGVAAAYVYFSV
RLGGTTEQVLRSLENILKP
 
Nucleotide Sequence: 900 bp     [Download]
>gi|564949884|ref|NC_023019.1|:4876153-4877052 Pseudomonas aeruginosa MTB-1, complete genome
ATGAACACCACTATCCAAATCGGCAATGACCGCATCGACCGAAACCCGCCGAAGCACGGCGCACCCGACA
CGCAGGTGGACCAACCGCCAGCGGCCGCGCCGCAGGACGACTTCCTGCGAACCGCCCCGAACGCCGACAT
TCGCGACAAAGGCAGCATGCTCTACGACTCGGTGTTTCGCATCGACCAGGATGACGACCTGCAATTCCAG
CTGCGCGGCCACAGCCTCAACCCCTTGATAGACGCCGCCCAGCCGCTGCTCGGCCTGGTGATACGCCTGC
GCCGCCTTGACCGGTGCGACGACATACCGAAGCTCTACGCGAGCGTCCGCGACCAGATAACCGCCCTTTC
CGAGGAGGTCCGCCAGCTTGGCTACGACGGCGCCACCCAGTTGGCCTATCGCTACGCCCTCTGCGCCTTC
ATCGACGAAGCCGTCATGGCCACCGCCTGGGGCCAAGCCTCACTGTGGCGCGAACGCTCCCTACTCAGCT
ACCACCACAACGAAACCTGGGGTGGCGAGAAGTTCTTCACCGTCCTGGCGCGCATGCAGATGGACCCGAC
CCGTTATCGCGACGTGCTGGAATTCAAGTACCTCTGCCTGTGCCTGGGCTTCCAGGGCAAGTACGGCCAG
CAGCACAACAACAGGGACACGCTCAACAGCATCATCGTCAAGCTGCACCGCATCCTGCGCGTGCAGCGCG
GCGATGCGCCCGAGCGCCTGACCGACGGAACCGACAACGTCGCTTCCCGCCGATATCGCCTGGCGCGCCA
GTGGCCCCTGTGGACGCCCTGGGCCATCGCCGTAGTCGGGGTAGCGGCAGCCTACGTCTACTTTTCTGTC
CGATTGGGCGGCACCACCGAGCAGGTGCTCCGGTCGCTGGAAAACATCCTGAAGCCCTGA