SecReT6
Protein ID: 564954422
SecReT6 ID880
T6SS typei1
Gene symbol-
Locus tagU769_22740
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]4880092..4880610 [+]
Producthypothetical protein
NoteTssD
UniProt IDV5T1D4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.10E-37, Aligned region: 6..155
Protein Sequence: 172 a.a.     [Download]
>gi|564954422|ref|YP_008886992.1| hypothetical protein U769_22740 [Pseudomonas aeruginosa MTB-1]
MPTPAYISIQGKTQGNITQGAFTADSVGNVYQEGHEDQILVQEIEHLIATPTDPQSGQPSGQRVHKPFIF
TAPLNKATPLLYQALASGEMLPEVEVKWYRTSTEGRQEHFFTTKLEDATIVNINTVLPHAQDPSKAEYTQ
LVKVAMAYRKITWTHAIAGTEASDDWRKPQEA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|564949884|ref|NC_023019.1|:4880092-4880610 Pseudomonas aeruginosa MTB-1, complete genome
ATGCCGACTCCCGCCTATATCAGCATCCAGGGCAAGACCCAGGGCAACATCACCCAGGGCGCCTTCACCG
CCGACTCCGTGGGCAACGTCTACCAGGAAGGCCACGAAGACCAGATTCTGGTCCAGGAAATCGAGCACCT
GATCGCCACGCCGACCGACCCGCAAAGCGGTCAGCCCTCCGGCCAGCGTGTGCACAAACCCTTTATCTTC
ACCGCGCCGCTGAACAAGGCCACGCCGCTGCTGTACCAGGCCCTGGCCTCTGGCGAAATGCTCCCGGAAG
TGGAAGTGAAGTGGTACCGGACCTCCACCGAAGGCCGTCAGGAGCACTTCTTCACCACCAAGCTCGAAGA
CGCCACCATCGTCAACATCAACACCGTGCTGCCGCACGCCCAGGACCCGAGCAAGGCCGAGTACACCCAG
CTCGTCAAGGTCGCCATGGCCTACCGCAAGATCACCTGGACCCACGCCATCGCCGGCACCGAAGCCTCGG
ACGACTGGCGCAAGCCCCAGGAAGCCTAA