SecReT6
Protein ID: 564954423
SecReT6 ID880
T6SS typei1
Gene symbol-
Locus tagU769_22745
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]4880710..4882755 [+]
Producttype IV secretion protein Rhs
NoteTssI
UniProt IDV5T259
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.00E-54, Aligned region: 27..326
Phage_base_V [PF04717], Evalue: 1.40E-20, Aligned region: 368..461
Gp5_C [PF06715], Evalue: 0.00038, Aligned region: 506..524
Gp5_C [PF06715], Evalue: 0.00038, Aligned region: 510..532
Gp5_C [PF06715], Evalue: 0.00038, Aligned region: 526..548
Gp5_C [PF06715], Evalue: 0.00038, Aligned region: 551..564
Gp5_C [PF06715], Evalue: 0.00038, Aligned region: 566..588
Gp5_C [PF06715], Evalue: 0.00038, Aligned region: 600..620
Gp5_C [PF06715], Evalue: 0.00038, Aligned region: 622..634
Gp5_C [PF06715], Evalue: 0.00038, Aligned region: 647..660
Protein Sequence: 681 a.a.     [Download]
>gi|564954423|ref|YP_008886993.1| type IV secretion protein Rhs [Pseudomonas aeruginosa MTB-1]
MAVQSDLRFTFSAGADAFEVVEFRLSEGLSETFLLDVELSCANPAIDFGQVLDRPALLTIWQGGQPVRYV
HGSVTSFQQGNTGFRRTRYRAIVEPRLARLRLASDWRIFQTLAVPDIAKVLLKKHAITLDYEQKVTNAHA
PREYCVQAGDTDYHFVERIMREEGFFYGFLHNAEGHRLIHCDRLWIFGKQPGLPVEYNPMAGGDRPGPAL
RSFTYSENVRTARQTQRDYNFKNPLYNQQTRREGNDLDHQASSYERYDYPGRYKSEVGEAFTQDRLRGHR
GDARQAIVEGDDARLVPGISFDLIGHPRRDMNRGWRPVLIEHHGKQYTSQAEESADAAQGTHYSSTATLV
PDDAEWRAEPMDKPLITGPQQATVVGPPGEEIYCDEFGRVKVQFPWDREGRNDEHSSCWIRVSQNISGAL
WGHMAIPRIGQEVIVSNFDGDPDQPVITGRSYNANQRPPYELPANKTRMTIKSQTHKGDGFNEIRFEDEA
DQEEVFIHAQKDQNNIVNNDETTFVGHDRSERVDNDETVSIGHDRKEDVGNDETISIGRHRKEDVGKNET
ISIGRNRRVTIGGHKTETITKTKAESIGLAKFLTIGAAYQTSVGAAMNTTVGLSQSEQVGINKSVIVGKT
YSTTAGEEFSLTVGKSSLVLKADGTVLINGVKFDFSSSEHTQISSKVVDIN
 
Nucleotide Sequence: 2046 bp     [Download]
>gi|564949884|ref|NC_023019.1|:4880710-4882755 Pseudomonas aeruginosa MTB-1, complete genome
ATGGCCGTCCAATCCGACCTGCGCTTCACCTTCTCCGCCGGCGCCGACGCGTTCGAAGTCGTCGAGTTCC
GCCTCTCCGAGGGTCTGTCCGAGACCTTTCTGTTGGATGTGGAGCTGAGCTGCGCCAACCCCGCCATAGA
CTTCGGCCAGGTCCTCGACCGCCCCGCACTGCTCACCATTTGGCAAGGCGGCCAGCCCGTGCGCTACGTG
CATGGCTCGGTGACCTCGTTCCAGCAGGGCAACACCGGCTTTCGCCGCACCCGCTACCGCGCCATCGTCG
AGCCGCGCCTGGCCCGCCTGCGGCTCGCCTCGGACTGGCGCATCTTCCAGACCCTGGCCGTGCCCGACAT
CGCCAAGGTGCTGCTCAAGAAGCACGCCATCACCCTGGACTACGAGCAGAAGGTCACCAACGCCCATGCC
CCGCGCGAGTACTGCGTGCAGGCCGGCGACACCGACTACCACTTCGTCGAACGCATCATGCGCGAGGAAG
GCTTCTTCTACGGCTTCCTCCACAACGCCGAAGGCCATCGCCTCATCCACTGCGACCGGCTGTGGATTTT
CGGCAAGCAACCCGGCCTGCCGGTGGAATACAACCCCATGGCCGGCGGCGACCGGCCGGGCCCGGCGCTT
CGCAGCTTCACCTACAGCGAGAACGTACGCACCGCGCGCCAGACCCAGCGCGACTACAACTTCAAGAACC
CGCTGTACAACCAGCAGACCCGGCGCGAAGGCAACGACCTGGACCACCAGGCCAGCAGCTACGAACGCTA
CGACTACCCTGGCCGCTACAAGAGCGAGGTGGGCGAGGCCTTCACCCAGGACCGCCTTCGCGGCCACCGC
GGCGACGCACGCCAGGCCATCGTCGAGGGCGACGACGCGCGGCTGGTGCCGGGTATCTCCTTCGACCTCA
TTGGCCACCCGCGCCGGGACATGAACCGCGGCTGGCGCCCCGTGCTCATCGAGCACCACGGCAAGCAGTA
CACCAGCCAGGCCGAGGAAAGCGCCGACGCCGCCCAGGGCACGCATTACAGCAGTACCGCCACCCTGGTA
CCGGATGACGCCGAGTGGCGGGCCGAGCCTATGGACAAGCCGCTAATCACCGGCCCCCAGCAGGCCACCG
TGGTCGGCCCGCCGGGCGAGGAAATCTACTGCGACGAATTCGGCCGGGTGAAGGTGCAGTTCCCGTGGGA
CAGGGAAGGTCGCAACGACGAACACAGCTCCTGCTGGATACGGGTGTCGCAGAACATCTCTGGAGCGCTC
TGGGGCCACATGGCCATTCCGCGCATCGGCCAGGAGGTCATCGTCAGCAATTTCGACGGTGACCCGGACC
AGCCCGTCATCACCGGCCGAAGCTACAACGCCAACCAGCGCCCGCCCTACGAGCTGCCGGCGAACAAGAC
GCGCATGACCATCAAGAGCCAGACTCACAAGGGCGATGGCTTCAACGAGATTCGCTTCGAAGACGAGGCT
GACCAGGAAGAAGTCTTCATCCACGCGCAGAAAGACCAGAACAACATCGTCAACAACGACGAAACCACCT
TCGTCGGCCACGACCGCAGTGAGCGCGTGGATAACGACGAAACCGTCTCCATCGGCCACGACCGCAAGGA
AGACGTCGGCAACGACGAGACCATCTCCATCGGCCGGCACCGCAAGGAAGACGTCGGCAAGAACGAGACC
ATCTCCATCGGCCGCAACCGCCGCGTCACCATCGGCGGGCACAAGACCGAGACCATCACCAAGACCAAGG
CCGAATCCATCGGCCTGGCCAAGTTCCTCACCATCGGCGCGGCCTACCAGACCAGCGTCGGAGCGGCCAT
GAACACCACGGTGGGATTGAGCCAATCCGAGCAGGTGGGCATCAACAAGTCGGTCATCGTCGGCAAGACC
TACAGCACCACTGCGGGCGAGGAGTTCTCCCTCACGGTCGGCAAATCCAGCCTGGTCCTGAAAGCCGACG
GCACCGTGCTGATTAACGGCGTGAAGTTCGACTTTTCCTCGTCCGAGCACACGCAGATATCCAGCAAGGT
CGTCGACATCAACTAG