SecReT6
Protein ID: 565638783
SecReT6 ID881
T6SS typei4b
Gene symbol-
Locus tagP795_10840
StrainAcinetobacter baumannii ZW85-1
Repliconchromosome [GenBank: NC_023028] [Browse all T6SS(s) in this replicon]
Location [Strand]2353802..2354608 [-]
Productaspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
NoteTssL
UniProt IDV5VEM3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.90E-53, Aligned region: 34..239
Protein Sequence: 268 a.a.     [Download]
>gi|565638783|ref|YP_008891026.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Acinetobacter baumannii ZW85-1]
MSQSTGAPSLFDDGQIGTGGNNNSQSQVKLQAINLIDLLHDGFYLIFLIRNQYVPADPQRFREKILDLLN
RFEQQAKKLQFSADDIHDAKYAFCALIDETIVTQQDPSYFNLQNSWLISPLQLSLFGSQLAGYQFFEILE
QLRSRGKERLAALEVFHYCLLLGFQGKYRIESIESLNHLVARVGDEIDYLKGKKVAFSPFSAIPDQIRNI
IHRELPFFWILIFLLIFALLTFAGLRFMLNNQNDKALSNYQNVISAPQEQAHITIYLP
 
Nucleotide Sequence: 807 bp     [Download]
>gi|565636615|ref|NC_023028.1|:c2354608-2353802 Acinetobacter baumannii ZW85-1, complete genome
ATGTCACAATCTACAGGTGCTCCTTCTTTATTTGACGATGGGCAAATTGGGACAGGGGGGAATAATAATA
GCCAGTCCCAAGTAAAGTTACAGGCAATTAATCTGATTGATTTATTGCATGATGGTTTTTACTTAATCTT
TTTAATTCGAAATCAGTATGTGCCAGCTGATCCACAGCGCTTTCGTGAAAAAATTCTAGATTTGCTTAAT
CGATTTGAGCAACAAGCGAAAAAGTTACAATTTTCAGCTGATGATATTCATGATGCTAAATATGCGTTTT
GTGCGCTAATTGATGAAACGATCGTAACCCAGCAAGACCCAAGCTATTTTAATTTACAAAATTCTTGGTT
AATTAGCCCATTACAGTTAAGTCTGTTTGGTTCTCAGTTAGCGGGTTATCAATTCTTCGAAATTTTAGAG
CAACTACGTAGTCGTGGAAAAGAGCGATTAGCTGCTCTTGAAGTCTTCCATTACTGCTTATTATTAGGTT
TTCAGGGTAAATACCGAATTGAGTCAATTGAAAGCCTTAACCATTTGGTGGCACGAGTAGGCGATGAAAT
TGATTATCTGAAAGGGAAAAAAGTGGCTTTTTCGCCATTCTCGGCAATTCCTGATCAGATACGAAATATT
ATCCATCGTGAGCTACCTTTTTTCTGGATTTTGATTTTCTTATTGATTTTTGCATTACTTACCTTTGCAG
GTTTAAGATTTATGCTTAACAATCAAAATGATAAAGCATTATCTAATTATCAAAATGTGATTTCTGCCCC
ACAAGAGCAGGCACATATTACAATTTACTTACCTTGA