SecReT6
Protein ID: 565638784
SecReT6 ID881
T6SS typei4b
Gene symbol-
Locus tagP795_10845
StrainAcinetobacter baumannii ZW85-1
Repliconchromosome [GenBank: NC_023028] [Browse all T6SS(s) in this replicon]
Location [Strand]2354626..2355990 [-]
Producthypothetical protein
NoteTssK
UniProt IDV5VER9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.50E-126, Aligned region: 19..451
Protein Sequence: 454 a.a.     [Download]
>gi|565638784|ref|YP_008891027.1| hypothetical protein P795_10845 [Acinetobacter baumannii ZW85-1]
MFKAEKVLWGEGLFLRPQHFQIQDTYHEQRLNHTVRAVVPFSYGVQKLSFDEAQLSTHILALESVEMIWQ
DGEIYQAPAYDLLPEPILLDELNLRGEMVIYLALPLLQANKQNLIDQNQSQKGRYQSHLVETHDLFTNAT
EADISLLRRRAVFKLLDAHSNPDHNLDGFLYLPIGKIKRQSSGAFEIDRKFIPPILHVDASETLVSNLKR
TLNVIKAKIKTIQTNNRENEQKLIEFRSGDIVSFWLVNALNTAHAGLSHFLQYPQIHPERLFFELLRLAG
SLLTFSTAYEVDQLPAYKHHNLQESFTQLDTILRDLLDTIISSRYISIALKEIRPSYWVGSLETDKITRD
TRLYIAVSSSAMQTHELIQIVPLRFKIGSTLDVEQRVVAALPAIPLHHLIQVPTAIPVRSGVSYFEIEPH
HELYQRMLDSETICIYVPAGFQDISIELIAVMNA
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|565636615|ref|NC_023028.1|:c2355990-2354626 Acinetobacter baumannii ZW85-1, complete genome
ATGTTTAAAGCTGAAAAAGTCCTGTGGGGCGAAGGTTTATTTTTAAGACCTCAACATTTCCAGATTCAAG
ATACCTATCATGAACAACGTTTAAATCATACGGTTCGTGCTGTTGTGCCATTTTCCTATGGCGTTCAAAA
ACTTAGTTTTGATGAAGCACAGTTAAGTACGCATATTCTTGCACTTGAATCAGTAGAAATGATTTGGCAA
GACGGTGAAATATATCAAGCGCCTGCTTATGACTTATTACCTGAACCTATTTTGCTTGATGAGCTTAATT
TACGTGGTGAAATGGTCATCTATTTGGCATTACCATTATTACAAGCCAATAAACAAAATTTAATCGATCA
AAATCAATCACAAAAGGGGCGCTATCAATCACATTTGGTTGAGACCCATGATCTGTTCACAAACGCGACA
GAGGCTGATATCAGCTTATTACGTCGTCGAGCTGTGTTTAAATTATTAGATGCACATAGTAATCCTGATC
ATAATTTAGATGGTTTCCTGTATTTGCCAATAGGCAAAATTAAACGTCAGAGTTCAGGTGCTTTTGAAAT
TGACCGCAAATTTATTCCGCCCATTTTGCATGTCGATGCATCTGAGACCTTGGTTTCAAATTTAAAAAGA
ACCTTGAATGTTATTAAGGCAAAAATTAAAACGATTCAAACCAATAACCGAGAAAATGAGCAGAAATTAA
TTGAATTCCGTTCAGGTGATATCGTTTCGTTTTGGTTGGTAAATGCTTTAAATACTGCTCATGCTGGTCT
GAGCCATTTCTTGCAATATCCGCAAATTCATCCGGAACGCTTATTCTTTGAATTGCTACGTTTGGCAGGT
TCATTATTAACTTTCTCGACAGCTTATGAAGTTGATCAGTTGCCTGCATATAAACATCATAATTTGCAAG
AGAGCTTCACCCAGCTCGACACAATTTTACGTGATTTACTCGATACGATTATTTCGAGTCGTTACATCAG
TATTGCCCTTAAAGAAATTCGCCCTTCATATTGGGTGGGAAGTCTCGAAACCGATAAGATTACTCGAGAT
ACCAGACTTTATATTGCTGTATCAAGTAGCGCGATGCAGACCCACGAGTTGATTCAAATCGTTCCTCTAC
GTTTTAAAATCGGTAGTACTTTAGATGTTGAACAACGTGTTGTTGCAGCATTACCAGCAATACCATTACA
TCACTTAATCCAAGTTCCAACTGCTATTCCAGTACGTTCGGGTGTGAGCTATTTTGAAATCGAACCGCAT
CATGAACTCTATCAACGTATGTTGGATTCAGAAACGATTTGTATTTATGTTCCGGCTGGATTCCAAGATA
TCAGTATTGAGCTGATTGCGGTCATGAACGCTTAA