SecReT6
Protein ID: 565638785
SecReT6 ID881
T6SS typei4b
Gene symbol-
Locus tagP795_10850
StrainAcinetobacter baumannii ZW85-1
Repliconchromosome [GenBank: NC_023028] [Browse all T6SS(s) in this replicon]
Location [Strand]2356007..2357101 [-]
Producthypothetical protein
NoteTssA
UniProt IDV5VG41
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.90E-20, Aligned region: 55..114
Protein Sequence: 364 a.a.     [Download]
>gi|565638785|ref|YP_008891028.1| hypothetical protein P795_10850 [Acinetobacter baumannii ZW85-1]
MSIDISELLKPINDSLLCGEDYSFSNEFHEIKKARTQDDLLLDQGDWVAERKQADWDFVAKSVSTLLIEK
TKDIRLLTWVIEAWTHLNGFEGMVKGITLTHTMLNQYWQDIHPIIEDDDLDQRIGLLQGLINQLPMLLKK
VPLTNTAPYYNLLDYDNFLYHENIRRKQTEEYESQSGPSELEQFDQAIFNTSKTFQYSNYQEFNSVLTEW
NVLKQTLDHLMGLDSPSFAAIDSAFETIHSTLRKIYKAEAFGTGLAPSQEQAAVITTPSMENQVPVQIVS
DQPMFQPQAQTHLANREQAMKVLQEIADYFQANEPHSPVSYMLQKTIKWSQMPLHEWLAQVIKDEHPLQM
VQEMLGVQPKNEYE
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|565636615|ref|NC_023028.1|:c2357101-2356007 Acinetobacter baumannii ZW85-1, complete genome
ATGAGTATTGATATTTCTGAACTACTTAAACCCATTAATGACAGCTTGCTTTGTGGTGAGGATTATTCAT
TTTCTAATGAATTTCACGAGATAAAGAAAGCCAGAACACAGGATGATCTATTATTAGATCAGGGGGATTG
GGTTGCTGAACGGAAGCAGGCAGATTGGGACTTTGTTGCGAAGAGTGTAAGCACTTTGCTCATTGAAAAA
ACCAAAGATATCCGTCTATTAACTTGGGTAATAGAAGCCTGGACTCATCTAAATGGTTTTGAAGGCATGG
TAAAGGGAATCACTTTAACTCATACCATGCTGAACCAATATTGGCAGGATATTCATCCAATTATTGAAGA
TGATGATTTGGATCAGCGTATTGGTTTATTACAAGGTCTTATTAATCAGTTGCCAATGCTGTTGAAGAAA
GTACCTTTAACTAACACAGCTCCTTATTATAACTTGCTTGATTACGATAATTTTCTATATCACGAAAATA
TACGCCGTAAGCAAACAGAAGAGTACGAGAGTCAGTCAGGTCCATCTGAATTAGAACAATTTGATCAAGC
GATCTTTAATACCTCTAAAACCTTTCAATACTCAAATTATCAAGAGTTTAATTCGGTTTTAACGGAGTGG
AATGTTTTAAAGCAGACACTCGACCATTTAATGGGATTAGATTCACCGAGTTTTGCTGCAATTGATTCTG
CATTTGAAACAATACACAGCACTTTACGTAAAATTTACAAAGCAGAGGCTTTTGGTACTGGGCTTGCGCC
GAGCCAAGAACAGGCCGCTGTCATCACGACACCGTCTATGGAAAATCAAGTGCCTGTACAAATCGTATCA
GACCAGCCTATGTTTCAGCCACAAGCACAAACTCACTTGGCCAATCGCGAGCAAGCAATGAAAGTGCTGC
AAGAAATAGCTGATTATTTTCAAGCAAATGAGCCACATAGTCCCGTGAGTTATATGCTCCAAAAGACCAT
TAAATGGAGCCAAATGCCGCTGCATGAATGGTTAGCACAAGTGATTAAAGATGAGCATCCATTGCAAATG
GTTCAGGAAATGTTAGGTGTTCAACCTAAAAATGAATATGAATAA