SecReT6
Protein ID: 565638786
SecReT6 ID881
T6SS typei4b
Gene symbol-
Locus tagP795_10855
StrainAcinetobacter baumannii ZW85-1
Repliconchromosome [GenBank: NC_023028] [Browse all T6SS(s) in this replicon]
Location [Strand]2357125..2359803 [-]
ProductPutative ClpA/B-type chaperone
NoteTssH
UniProt IDV5VEE1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.50E-43, Aligned region: 228..306
AAA_2 [PF07724], Evalue: 1.50E-43, Aligned region: 605..773
AAA [PF00004], Evalue: 2.80E-23, Aligned region: 229..342
AAA [PF00004], Evalue: 2.80E-23, Aligned region: 610..728
AAA_5 [PF07728], Evalue: 5.60E-14, Aligned region: 229..251
AAA_5 [PF07728], Evalue: 5.60E-14, Aligned region: 609..730
ClpB_D2-small [PF10431], Evalue: 2.70E-12, Aligned region: 383..396
ClpB_D2-small [PF10431], Evalue: 2.70E-12, Aligned region: 779..849
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 9..72
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 206..251
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 273..308
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 476..517
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 604..653
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 675..703
AAA_22 [PF13401], Evalue: 1.20E-08, Aligned region: 228..322
AAA_22 [PF13401], Evalue: 1.20E-08, Aligned region: 458..502
AAA_22 [PF13401], Evalue: 1.20E-08, Aligned region: 606..636
Sigma54_activat [PF00158], Evalue: 1.00E-07, Aligned region: 226..246
Sigma54_activat [PF00158], Evalue: 1.00E-07, Aligned region: 606..716
AAA_19 [PF13245], Evalue: 1.10E-07, Aligned region: 229..249
AAA_19 [PF13245], Evalue: 1.10E-07, Aligned region: 605..631
AAA_25 [PF13481], Evalue: 5.80E-07, Aligned region: 229..261
AAA_25 [PF13481], Evalue: 5.80E-07, Aligned region: 284..325
AAA_25 [PF13481], Evalue: 5.80E-07, Aligned region: 605..636
AAA_25 [PF13481], Evalue: 5.80E-07, Aligned region: 832..864
AAA_14 [PF13173], Evalue: 6.20E-07, Aligned region: 229..332
AAA_14 [PF13173], Evalue: 6.20E-07, Aligned region: 607..692
AAA_17 [PF13207], Evalue: 1.40E-06, Aligned region: 229..276
AAA_17 [PF13207], Evalue: 1.40E-06, Aligned region: 465..494
AAA_17 [PF13207], Evalue: 1.40E-06, Aligned region: 608..646
IstB_IS21 [PF01695], Evalue: 1.90E-06, Aligned region: 223..289
IstB_IS21 [PF01695], Evalue: 1.90E-06, Aligned region: 609..629
NACHT [PF05729], Evalue: 5.10E-06, Aligned region: 229..326
NACHT [PF05729], Evalue: 5.10E-06, Aligned region: 609..648
AAA_18 [PF13238], Evalue: 8.10E-06, Aligned region: 229..255
AAA_18 [PF13238], Evalue: 8.10E-06, Aligned region: 485..540
AAA_18 [PF13238], Evalue: 8.10E-06, Aligned region: 610..639
Zeta_toxin [PF06414], Evalue: 2.00E-05, Aligned region: 229..249
Zeta_toxin [PF06414], Evalue: 2.00E-05, Aligned region: 604..649
Arch_ATPase [PF01637], Evalue: 2.40E-05, Aligned region: 62..105
Arch_ATPase [PF01637], Evalue: 2.40E-05, Aligned region: 208..242
Arch_ATPase [PF01637], Evalue: 2.40E-05, Aligned region: 281..378
Arch_ATPase [PF01637], Evalue: 2.40E-05, Aligned region: 467..522
Arch_ATPase [PF01637], Evalue: 2.40E-05, Aligned region: 605..655
RuvB_N [PF05496], Evalue: 0.00021, Aligned region: 228..247
RuvB_N [PF05496], Evalue: 0.00021, Aligned region: 299..309
RuvB_N [PF05496], Evalue: 0.00021, Aligned region: 573..631
RuvB_N [PF05496], Evalue: 0.00021, Aligned region: 678..704
AAA_29 [PF13555], Evalue: 0.00034, Aligned region: 221..245
AAA_29 [PF13555], Evalue: 0.00034, Aligned region: 604..633
AAA_29 [PF13555], Evalue: 0.00034, Aligned region: 713..733
RNA_helicase [PF00910], Evalue: 0.00092, Aligned region: 230..253
RNA_helicase [PF00910], Evalue: 0.00092, Aligned region: 610..631
T2SE [PF00437], Evalue: 0.001, Aligned region: 214..248
T2SE [PF00437], Evalue: 0.001, Aligned region: 422..458
T2SE [PF00437], Evalue: 0.001, Aligned region: 581..678
Atg14 [PF10186], Evalue: 0.0019, Aligned region: 437..519
AAA_28 [PF13521], Evalue: 0.0021, Aligned region: 229..261
AAA_28 [PF13521], Evalue: 0.0021, Aligned region: 609..632
DUF258 [PF03193], Evalue: 0.0038, Aligned region: 224..248
DUF258 [PF03193], Evalue: 0.0038, Aligned region: 588..632
NTPase_1 [PF03266], Evalue: 0.0043, Aligned region: 229..249
NTPase_1 [PF03266], Evalue: 0.0043, Aligned region: 280..305
NTPase_1 [PF03266], Evalue: 0.0043, Aligned region: 609..630
TIP49 [PF06068], Evalue: 0.0052, Aligned region: 229..252
TIP49 [PF06068], Evalue: 0.0052, Aligned region: 278..309
TIP49 [PF06068], Evalue: 0.0052, Aligned region: 609..644
Clp_N [PF02861], Evalue: 0.0067, Aligned region: 31..73
Clp_N [PF02861], Evalue: 0.0067, Aligned region: 101..131
MobB [PF03205], Evalue: 0.0067, Aligned region: 230..263
MobB [PF03205], Evalue: 0.0067, Aligned region: 608..639
AAA_33 [PF13671], Evalue: 0.0086, Aligned region: 230..300
AAA_33 [PF13671], Evalue: 0.0086, Aligned region: 608..630
Protein Sequence: 892 a.a.     [Download]
>gi|565638786|ref|YP_008891029.1| Putative ClpA/B-type chaperone [Acinetobacter baumannii ZW85-1]
MSSLKILITKLSTAARTALEKSANACVLQQNYEIEIEHLFLELLNQPLENDLKILLKKYKISADALADDL
KETISQLPKGNTRTPIFAKSIVRLFEQAWLLASAEQNPVIRSGHLLVALLTAPDLYQIATRASSLFDLFP
IDSMKHKFLEICEKSVEQQEESKTSSQADELEQAVTPTAKTQKTPALDQYTINLTEKAKNGGIDPVIGRE
YEIRLMLDILMRRRQNNPILTGEPGVGKTAVVEGLALKIAQGLVPEALKNVHLHVLDMGLLQAGASVKGE
FENRLKHVIQEVQSSAHPIILFIDEAHTLIGAGGQAGQNDAANLLKPALARGELRTIAATTWAEYKQYFE
KDAALSRRFQVVKVEEPTEEVAVDMLRAMIPVMQKHFNLQIDDEAIVTAVHASHRYISGRQLPDKAVSVL
DTAAARVALTQNAQPVKLDQLKAQEHNLKLEQQILENEHRQIPIHHERLEKLKNQLESLQSEIQETQEQW
QKELELVRKIQELEAQSHSNESEAYDQINLIRKDLADIQGQQPLVFERVNSQIINEIISDWTGIPVGKMV
NDEIKQILTLEDKLGERVMGQDYALTQLVQGIKTSKAKLEDPNKPQGVFLLVGPSGVGKTETALALANEL
YGGEQHLITINMSEYQEAHTVSSLKGAPPGYVGYGQGGVLTEAVRRNPYSVVLLDEIEKAHSDVQELFYQ
VFDKGTLEDGEGRVIDFKNTTILLTSNTGSSAIMQACLNQPVEEWPTAEDLIEHLKPSLYKQFKPAFLGR
MRVVPYFPLHDDLLVRIIKHKLGKITARIEKQYGTEVQYSDDLVELLLSRCTEVDSGARNVDNILNSTVL
PALATEILVALADQKLPKLIMIDAKDDEIQYLLDPVAKPAKKPTSKKLKSEV
 
Nucleotide Sequence: 2679 bp     [Download]
>gi|565636615|ref|NC_023028.1|:c2359803-2357125 Acinetobacter baumannii ZW85-1, complete genome
ATGAGTAGTTTAAAAATTTTAATTACAAAACTTTCTACAGCTGCACGCACTGCTTTAGAAAAATCTGCTA
ATGCTTGTGTTCTTCAGCAAAACTACGAAATTGAAATTGAACATTTATTTTTAGAGTTACTTAATCAGCC
TTTAGAAAACGATTTAAAAATTTTATTAAAAAAATATAAAATCTCAGCCGATGCTTTAGCAGATGATTTA
AAAGAAACAATTTCTCAATTACCAAAAGGTAATACACGTACTCCAATTTTTGCTAAATCAATTGTTCGTT
TATTTGAACAAGCTTGGTTATTGGCTTCAGCAGAACAAAATCCTGTCATTCGTAGTGGTCATTTACTGGT
TGCATTATTAACTGCACCTGACCTCTATCAAATTGCAACGAGAGCTTCGAGTTTATTCGATCTTTTCCCG
ATAGACTCAATGAAACATAAGTTTCTCGAAATTTGTGAAAAAAGTGTAGAACAACAAGAAGAATCAAAAA
CATCTTCACAAGCAGATGAATTAGAACAAGCCGTGACTCCAACTGCAAAAACTCAAAAAACACCTGCTTT
AGATCAATATACAATTAATTTAACTGAAAAAGCGAAGAATGGTGGGATTGACCCTGTTATTGGGCGTGAA
TATGAAATTCGTTTGATGCTCGATATTTTAATGCGTAGACGTCAGAACAACCCAATTTTAACTGGTGAGC
CAGGTGTAGGTAAAACAGCTGTAGTTGAAGGGTTGGCTTTAAAAATTGCTCAAGGTTTAGTTCCTGAAGC
ATTAAAAAATGTTCATTTGCACGTTTTAGATATGGGGCTTTTGCAAGCTGGGGCAAGTGTTAAAGGTGAA
TTTGAAAACCGTTTAAAGCACGTTATTCAAGAAGTCCAATCATCGGCTCATCCTATTATTTTATTTATTG
ATGAAGCACATACGCTTATTGGAGCTGGTGGCCAAGCGGGGCAAAACGATGCTGCCAATCTTTTAAAACC
TGCACTTGCACGTGGCGAGTTACGTACTATTGCTGCAACGACATGGGCAGAATATAAACAGTATTTTGAG
AAAGATGCTGCATTGAGCCGCCGTTTTCAGGTGGTAAAGGTTGAAGAACCGACCGAAGAAGTTGCTGTAG
ATATGTTACGTGCAATGATTCCCGTAATGCAAAAGCACTTTAATTTACAAATTGATGATGAAGCAATTGT
AACGGCTGTACATGCCTCTCATCGCTATATTAGTGGTCGTCAACTCCCAGACAAAGCAGTAAGTGTTCTT
GATACTGCGGCAGCGCGTGTAGCTTTGACCCAAAATGCACAGCCAGTCAAACTTGATCAATTAAAAGCAC
AAGAACATAACTTAAAGCTTGAGCAACAAATTTTGGAAAATGAACACCGTCAAATTCCAATACATCATGA
AAGATTAGAAAAACTGAAAAACCAACTAGAGTCATTACAAAGTGAGATCCAAGAGACTCAGGAACAATGG
CAAAAAGAATTAGAGCTAGTTCGTAAAATTCAGGAATTGGAAGCGCAGAGCCATTCTAATGAGTCTGAAG
CCTACGATCAGATTAATTTAATACGCAAAGACCTTGCTGATATTCAGGGACAACAGCCGTTAGTTTTTGA
GCGAGTAAACTCTCAGATCATCAATGAAATTATTTCTGATTGGACAGGTATTCCTGTTGGGAAAATGGTC
AATGATGAAATTAAGCAGATTTTAACGCTTGAAGATAAATTAGGTGAGCGTGTAATGGGGCAAGATTATG
CACTTACACAATTAGTTCAAGGGATTAAAACTTCAAAAGCTAAATTAGAAGATCCAAATAAACCTCAAGG
GGTGTTCCTTTTAGTTGGACCTAGTGGGGTTGGTAAAACCGAAACTGCTTTAGCCTTGGCTAATGAGTTA
TATGGCGGTGAACAGCATTTAATCACGATTAATATGTCTGAGTATCAAGAAGCACATACTGTCTCTTCGC
TTAAAGGTGCACCTCCAGGCTATGTTGGCTATGGTCAGGGTGGGGTTTTAACTGAAGCTGTACGCCGTAA
TCCTTATAGTGTTGTGTTACTCGACGAAATTGAAAAAGCACATAGCGATGTTCAGGAGTTGTTCTATCAA
GTATTTGATAAAGGTACTTTAGAGGATGGTGAAGGGCGCGTTATTGATTTTAAAAACACGACAATCTTAT
TAACTTCAAATACGGGCTCGAGTGCAATTATGCAGGCATGTTTAAATCAGCCTGTAGAAGAATGGCCTAC
CGCAGAAGATTTAATCGAACATTTAAAGCCGAGTTTATATAAACAGTTTAAGCCAGCCTTTTTAGGGCGT
ATGAGAGTTGTGCCATATTTCCCATTGCATGATGATTTATTGGTTCGAATTATTAAACATAAATTGGGCA
AAATTACTGCTCGAATTGAAAAACAATATGGAACGGAAGTTCAATATTCAGATGACTTGGTTGAATTGCT
ACTCAGCCGTTGTACTGAAGTGGATAGTGGCGCCCGTAATGTTGATAACATCTTAAATTCTACAGTTTTA
CCTGCTTTGGCAACTGAAATTTTAGTGGCGTTAGCAGATCAAAAATTGCCGAAATTGATCATGATTGATG
CAAAAGATGACGAGATCCAATATTTACTAGATCCTGTGGCGAAGCCTGCTAAAAAACCGACTAGTAAAAA
GTTGAAATCAGAAGTTTAA