SecReT6
Protein ID: 565638787
SecReT6 ID881
T6SS typei4b
Gene symbol-
Locus tagP795_10860
StrainAcinetobacter baumannii ZW85-1
Repliconchromosome [GenBank: NC_023028] [Browse all T6SS(s) in this replicon]
Location [Strand]2360026..2360289 [-]
Producthypothetical protein
NotePAAR
UniProt IDV5VEA4
KEGG IDabaz:P795_10860
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.10E-21, Aligned region: 7..79
Protein Sequence: 87 a.a.     [Download]
>gi|565638787|ref|YP_008891030.1| hypothetical protein P795_10860 [Acinetobacter baumannii ZW85-1]
MASPYITIGCPTTGGGQVISGNSAFLIEGIAIACVGDKATCPAHKTVSTIVSGDPNMQVMGKAAARVNDS
LSCGCKLLPKQSLVNQG
 
Nucleotide Sequence: 264 bp     [Download]
>gi|565636615|ref|NC_023028.1|:c2360289-2360026 Acinetobacter baumannii ZW85-1, complete genome
ATGGCTAGCCCTTACATTACGATTGGATGCCCAACGACAGGTGGAGGGCAAGTCATTTCTGGTAATAGTG
CATTTTTAATTGAGGGAATCGCAATTGCATGTGTAGGTGATAAAGCAACTTGTCCGGCGCATAAAACGGT
TTCTACGATTGTTTCCGGTGACCCAAATATGCAAGTGATGGGAAAAGCAGCAGCAAGAGTAAATGATTCA
TTATCGTGTGGCTGTAAATTATTACCGAAACAAAGTTTGGTCAATCAAGGGTAG