SecReT6
Protein ID: 565638788
SecReT6 ID881
T6SS typei4b
Gene symbol-
Locus tagP795_10865
StrainAcinetobacter baumannii ZW85-1
Repliconchromosome [GenBank: NC_023028] [Browse all T6SS(s) in this replicon]
Location [Strand]2360306..2361073 [-]
ProductOmpA/MotB domain protein
NoteTagL
UniProt IDV5VEM9
KEGG IDabaz:P795_10865
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.20E-24, Aligned region: 21..44
OmpA [PF00691], Evalue: 1.20E-24, Aligned region: 154..248
BON [PF04972], Evalue: 0.0046, Aligned region: 31..66
Protein Sequence: 255 a.a.     [Download]
>gi|565638788|ref|YP_008891031.1| OmpA/MotB domain protein [Acinetobacter baumannii ZW85-1]
MNQKYQIKLSQLIKGCFIYAIANYALAQPIVVEGVVPNEASKQAILMKMQSVYGADQVVDKIQVRPVAAP
NGWSDSVTRVITPDLKKVSQGKLSVNGTRFELTGKMLNPTEIQPTIQSFQSLVQPPYQLFSQLSVNQAEQ
KIIDDALKNRIIEFESGSAVLTEAGQKILDEMAVALNKVGGKKVKIVGHTDSSGDATKNLKLSQDRALAV
KNYLISKNIPADHLSTEGLGSSKPVADNTSAEGRKKNRRIEFTVL
 
Nucleotide Sequence: 768 bp     [Download]
>gi|565636615|ref|NC_023028.1|:c2361073-2360306 Acinetobacter baumannii ZW85-1, complete genome
ATGAATCAAAAATATCAAATTAAACTTTCACAACTTATAAAAGGCTGTTTTATATATGCAATTGCGAATT
ATGCTTTAGCACAGCCTATAGTTGTAGAAGGTGTAGTGCCAAATGAAGCAAGTAAACAGGCTATTTTAAT
GAAAATGCAGTCTGTTTATGGTGCAGATCAAGTTGTCGATAAAATACAAGTTCGACCTGTTGCCGCTCCA
AATGGATGGAGTGACTCTGTTACACGAGTGATTACACCTGATCTTAAAAAAGTTTCTCAGGGTAAGTTAA
GTGTTAATGGAACCCGATTTGAACTGACCGGGAAAATGCTAAATCCGACAGAAATACAGCCAACCATTCA
GTCTTTTCAGAGTTTGGTACAGCCTCCATATCAATTATTTTCCCAGCTTTCTGTAAATCAGGCTGAGCAG
AAGATTATTGATGATGCTTTAAAAAATCGAATTATTGAATTTGAATCTGGTAGTGCAGTATTAACTGAAG
CTGGGCAAAAAATTCTTGATGAAATGGCTGTTGCTTTAAATAAAGTGGGCGGGAAAAAAGTCAAAATTGT
GGGGCATACCGATAGTTCTGGTGATGCGACCAAAAACTTAAAACTCAGCCAAGATCGAGCTTTAGCAGTT
AAAAATTATTTAATTAGTAAGAATATTCCTGCTGATCATTTATCTACCGAAGGTTTAGGTTCATCTAAGC
CTGTAGCGGACAATACTTCTGCGGAAGGTAGAAAGAAAAACCGCCGAATTGAGTTCACCGTTTTATAG