SecReT6
Protein ID: 565638792
SecReT6 ID881
T6SS typei4b
Gene symbol-
Locus tagP795_10885
StrainAcinetobacter baumannii ZW85-1
Repliconchromosome [GenBank: NC_023028] [Browse all T6SS(s) in this replicon]
Location [Strand]2367337..2368335 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDV5VEB0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.20E-63, Aligned region: 18..312
Protein Sequence: 332 a.a.     [Download]
>gi|565638792|ref|YP_008891035.1| type VI secretion protein [Acinetobacter baumannii ZW85-1]
MQSERWWQDSSVTAELFQRPKSFEFIQATRLLRHMPANDAALSWSDHFKFETSFNLNFPATEIESLELVD
ERVHLTNLIVGLTGIQGALPYTYTNKIKQAPRQQRAETKEFLSLFNHKLTSQYVESSITYHLPVRYEIEN
KNDYLDILHALNGYVRSQHQQQDLDEYFAEFSGLMQGQNNTVHALKTMLSCIFKHEITIKEFVQESFKLA
GDQLTTLGGSQPSLLGINTFCGETIQQIDGKIEIQIGPLKRQQYLKFLPHQELSLKLKKIVETWCSPTLS
IDLRLILDESEIQPVRLTQGQESGLGQGAFLMSRKPNTHNDETCYSLIGEQI
 
Nucleotide Sequence: 999 bp     [Download]
>gi|565636615|ref|NC_023028.1|:c2368335-2367337 Acinetobacter baumannii ZW85-1, complete genome
ATGCAGTCAGAACGTTGGTGGCAAGACTCTTCTGTAACGGCTGAGTTGTTTCAACGCCCTAAGTCTTTTG
AGTTTATTCAAGCAACACGTTTATTGCGTCATATGCCTGCCAATGACGCAGCTTTGTCATGGTCTGACCA
TTTTAAATTTGAGACCTCATTTAACTTAAATTTTCCGGCCACTGAAATTGAAAGTTTAGAGTTAGTAGAT
GAGCGTGTTCATTTAACAAACCTGATCGTTGGTCTTACCGGTATACAGGGTGCATTACCTTATACATATA
CAAATAAAATTAAGCAGGCTCCAAGGCAACAACGCGCTGAAACGAAAGAGTTTTTAAGCTTGTTTAATCA
TAAGTTGACCAGTCAGTATGTAGAGTCAAGTATTACTTATCACTTGCCTGTGCGCTATGAAATTGAAAAT
AAAAATGATTATTTGGATATTCTCCATGCATTGAATGGCTATGTTCGCTCACAACATCAGCAACAAGACT
TGGATGAATATTTCGCTGAATTTTCAGGCCTAATGCAGGGGCAAAATAATACGGTTCATGCTTTAAAGAC
GATGTTGAGTTGTATTTTTAAGCATGAAATTACAATTAAAGAGTTTGTACAGGAATCGTTTAAGTTAGCG
GGTGATCAGCTAACCACTTTAGGTGGAAGTCAACCGAGCTTACTTGGTATTAACACATTTTGTGGGGAAA
CGATTCAACAAATTGATGGAAAAATTGAGATTCAAATAGGTCCGCTTAAGCGTCAACAATATTTAAAATT
TTTACCTCATCAAGAGCTTAGCTTAAAGCTCAAAAAAATCGTAGAAACCTGGTGCAGTCCAACTTTATCG
ATAGATTTAAGATTGATATTGGATGAGTCTGAAATACAACCTGTTCGCTTAACTCAAGGCCAAGAAAGTG
GCCTAGGGCAAGGCGCTTTTTTAATGTCTCGTAAGCCTAATACACATAACGATGAAACATGTTATAGCCT
TATAGGAGAGCAAATATGA