SecReT6
Protein ID: 565638794
SecReT6 ID881
T6SS typei4b
Gene symbol-
Locus tagP795_10895
StrainAcinetobacter baumannii ZW85-1
Repliconchromosome [GenBank: NC_023028] [Browse all T6SS(s) in this replicon]
Location [Strand]2370127..2370603 [-]
Producttype VI secretion system lysozyme-related protein
NoteTssE
UniProt IDV5VES8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-18, Aligned region: 32..135
Protein Sequence: 158 a.a.     [Download]
>gi|565638794|ref|YP_008891037.1| type VI secretion system lysozyme-related protein [Acinetobacter baumannii ZW85-1]
MNLDRLYPYGFRSTLFDRLIPESEDYAKGLSIQQLRESVAKDLEDLLNSRVAKLDHVIDDYPLVKKSILQ
FGIIDFVGLSTANPLDRDKICQSIEQSIAAHEPRLRQIRVEMLLDGHNMGALCLSIQAYLNIHPLYEPVV
FDALLKPTTQQYVISART
 
Nucleotide Sequence: 477 bp     [Download]
>gi|565636615|ref|NC_023028.1|:c2370603-2370127 Acinetobacter baumannii ZW85-1, complete genome
ATGAACTTAGATCGGCTTTATCCATACGGATTTCGTTCAACTTTATTTGATCGCTTAATTCCAGAAAGTG
AAGATTATGCAAAAGGTCTTTCTATTCAGCAATTAAGAGAATCTGTAGCAAAGGATTTAGAAGATTTGCT
CAATAGTCGGGTAGCAAAGTTAGATCATGTGATTGATGACTATCCACTTGTAAAAAAATCGATACTTCAG
TTCGGGATTATTGATTTTGTGGGGCTTTCTACAGCCAACCCTCTGGATCGGGATAAAATTTGCCAATCCA
TTGAGCAATCAATAGCAGCTCATGAACCTCGGCTAAGACAAATACGGGTAGAGATGTTATTAGATGGACA
TAATATGGGCGCATTATGTTTAAGTATTCAGGCTTATCTAAATATTCACCCCTTATATGAACCTGTTGTA
TTTGATGCATTGTTAAAACCAACAACGCAGCAATATGTAATTTCAGCAAGAACTTAA