SecReT6
Protein ID: 565638797
SecReT6 ID881
T6SS typei4b
Gene symbol-
Locus tagP795_10910
StrainAcinetobacter baumannii ZW85-1
Repliconchromosome [GenBank: NC_023028] [Browse all T6SS(s) in this replicon]
Location [Strand]2372710..2373213 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDR9RIN9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-58, Aligned region: 11..166
Protein Sequence: 167 a.a.     [Download]
>gi|565638797|ref|YP_008891040.1| type VI secretion protein [Acinetobacter baumannii ZW85-1]
MAKRESVQKKLQRIRPPRVQLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDKKFINVDLDNI
DEVMESLSPRAAFQVDNTLTEEGGKMAVDLTFKSMEDFRPENVVQQVDPLKKLVEARERLTDLRNKISNS
ERLEDLLDEVLKNTDQIRKLSAEADHE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|565636615|ref|NC_023028.1|:c2373213-2372710 Acinetobacter baumannii ZW85-1, complete genome
ATGGCTAAGAGAGAAAGCGTACAAAAGAAGCTTCAGCGAATTCGACCTCCACGTGTTCAGCTTACATATG
ATGTCGAAATTGGTGATGCGAAAGAAGCGAAAGAACTACCATTCGTTGTAGGTGTAATGGGTGATTTTTC
AGCTGCATCTGAGCTTGAGCGTACAAAATTAAAAGATAAAAAATTCATTAATGTCGATTTAGATAATATT
GATGAAGTAATGGAATCTCTGTCTCCAAGAGCTGCTTTTCAAGTAGACAATACGTTGACAGAAGAAGGCG
GTAAAATGGCTGTTGATTTAACATTTAAATCAATGGAAGATTTTCGCCCGGAAAATGTTGTACAGCAAGT
TGATCCATTAAAGAAATTGGTTGAGGCGCGTGAGCGTTTAACCGATTTAAGAAACAAAATTTCAAACAGT
GAGCGTTTAGAAGATCTGCTTGATGAGGTTCTTAAAAATACTGATCAAATCCGTAAATTAAGTGCGGAGG
CCGATCATGAATAA