SecReT6
Protein ID: 565638808
SecReT6 ID881
T6SS typei4b
Gene symbol-
Locus tagP795_10965
StrainAcinetobacter baumannii ZW85-1
Repliconchromosome [GenBank: NC_023028] [Browse all T6SS(s) in this replicon]
Location [Strand]2381874..2383994 [-]
Productrhs element Vgr family protein
NoteTssI
UniProt IDV5VEP7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 2.20E-45, Aligned region: 525..677
T6SS_Vgr [PF13296], Evalue: 2.60E-39, Aligned region: 394..502
T6SS_Vgr [PF13296], Evalue: 2.60E-39, Aligned region: 545..585
Phage_GPD [PF05954], Evalue: 2.60E-29, Aligned region: 1..215
Phage_base_V [PF04717], Evalue: 3.00E-18, Aligned region: 274..374
Sarcoglycan_1 [PF04790], Evalue: 0.00054, Aligned region: 537..589
Sarcoglycan_1 [PF04790], Evalue: 0.00054, Aligned region: 605..656
DUF3540 [PF12059], Evalue: 0.0021, Aligned region: 521..584
DUF3540 [PF12059], Evalue: 0.0021, Aligned region: 599..652
Protein Sequence: 706 a.a.     [Download]
>gi|565638808|ref|YP_008891051.1| rhs element Vgr family protein [Acinetobacter baumannii ZW85-1]
MQSNESDYDFLTRLWRSEGINWLVDESQLFVADPNASIQPQVLRLIDDNQNYQALERRSIRYQRSSATEQ
FDTITQVKAERRLQPTSVHVQRWQADALQQEEGSGSVQGTQKHSEHYDNASLNLEDAWHVSPAWMQDLNG
EDQATASGNSQIEQLNQHINAYHHLSSKQFTVAGNVRDAQVGYWFELNDHPELDQHDSADKEFLILNKHY
YNQNNLPKELQQQLERLLPQGKLKAAQLDSQNPEQRHFAELNVVRRNIKAVPEYNPLEHRPAAHPQRARV
VGLEGESIHVDQWGRIKVRFLFTRADDHSHDGGAGSNDNDTDSAWVDVLTPWAGAGYGARFLPRVGEIVV
IDFFDGNIDRPFVVGRIHEAERHPTQFDQKGQLPDTKKLSGIRSEEVDGKGFNQLRFDDTTGQISAQLQS
SHAASQLNLGNLSHPKDKAESDGRGEGFELRTDQWGAVRAGSGLLVSTHKQDQAQGVHLDASEAKQQIEG
GLNNAKALSEVAKNQQTDPLDMLENIQTFLEVLKQEDPKKAAEFQSAVMLLASPKSIAVSSNEDIHLSAN
GQLTQSAGDSINMSTQKNIVNHASQKISLFAAQEGARLFAGKGKVEIQAQGDGLDVIARKGVQITSTEDT
VYITSPTEINLTANGSQVKLNDSGIFPVTGGKLEVKAGQHLFRGGSSINPPALDLPDCSAKQTQAAQNGS
AKVDLS
 
Nucleotide Sequence: 2121 bp     [Download]
>gi|565636615|ref|NC_023028.1|:c2383994-2381874 Acinetobacter baumannii ZW85-1, complete genome
ATGCAGTCAAACGAAAGCGATTATGACTTTTTAACCCGTTTGTGGCGTAGTGAAGGTATTAACTGGCTGG
TCGATGAGTCACAGCTTTTTGTCGCTGACCCGAATGCTTCTATTCAGCCACAGGTCTTACGTTTAATTGA
CGATAACCAAAATTATCAGGCACTTGAACGCCGTAGCATCCGCTATCAACGCAGCAGTGCGACAGAGCAG
TTCGATACCATTACCCAAGTCAAAGCTGAGCGTCGTTTACAACCAACCTCGGTTCATGTGCAACGCTGGC
AAGCCGATGCTTTGCAGCAAGAAGAAGGTAGCGGCAGCGTACAAGGCACGCAAAAGCACAGCGAACACTA
TGACAATGCTAGCCTGAACCTTGAAGATGCATGGCATGTTAGCCCAGCGTGGATGCAGGATTTAAACGGG
GAAGATCAAGCCACCGCTTCAGGCAATAGCCAGATTGAACAGCTTAACCAGCACATCAATGCTTACCATC
ACTTGAGTTCTAAACAGTTTACCGTTGCAGGGAATGTCCGTGATGCACAGGTAGGTTACTGGTTTGAGCT
GAATGACCACCCAGAACTCGACCAGCATGACAGTGCGGACAAAGAGTTCTTAATCTTAAACAAGCACTAC
TATAACCAGAATAATTTACCGAAAGAATTACAACAGCAACTTGAGCGCTTATTACCACAAGGCAAACTCA
AGGCAGCCCAACTCGACAGTCAAAACCCTGAGCAGCGCCACTTTGCTGAGCTGAACGTTGTTCGTCGTAA
CATCAAAGCTGTGCCTGAATATAACCCGCTAGAGCACCGACCAGCCGCTCACCCACAGCGCGCTAGAGTG
GTGGGTTTAGAGGGTGAAAGCATTCATGTCGACCAGTGGGGACGCATTAAAGTCCGTTTCCTGTTTACCC
GAGCTGATGACCACAGTCATGATGGTGGAGCAGGAAGTAACGACAATGACACCGACTCCGCTTGGGTCGA
TGTGCTGACCCCATGGGCGGGTGCAGGTTATGGCGCACGTTTCTTGCCACGTGTTGGTGAAATTGTTGTC
ATCGATTTCTTTGATGGCAACATTGACCGTCCGTTTGTGGTGGGGCGTATTCATGAAGCTGAACGCCACC
CAACGCAATTCGACCAGAAAGGGCAGTTACCTGATACTAAAAAACTCAGCGGCATTCGTTCAGAAGAAGT
TGATGGCAAAGGCTTTAATCAGCTCCGTTTTGATGACACCACAGGCCAAATCAGTGCCCAGCTACAAAGT
AGCCATGCAGCCAGCCAGCTAAACTTGGGTAACTTAAGCCATCCAAAAGACAAGGCAGAAAGTGATGGTC
GTGGGGAAGGTTTTGAACTCAGAACTGACCAATGGGGAGCAGTCAGAGCAGGCAGTGGTTTACTCGTTAG
TACCCACAAACAGGATCAGGCTCAAGGTGTACACCTTGATGCAAGCGAGGCCAAGCAACAAATCGAAGGC
GGCCTCAATAATGCCAAGGCACTCAGTGAAGTTGCTAAAAATCAGCAAACTGACCCGTTAGATATGCTTG
AGAATATTCAGACTTTCTTAGAAGTTCTCAAACAAGAAGATCCTAAAAAAGCTGCTGAATTTCAATCAGC
AGTGATGCTGCTGGCATCACCAAAAAGTATTGCTGTAAGTAGTAATGAAGATATACACCTCAGTGCAAAT
GGTCAGCTCACTCAAAGTGCTGGAGATAGCATTAATATGAGTACGCAAAAGAATATAGTGAATCATGCGA
GCCAAAAGATTAGCCTCTTTGCCGCTCAGGAGGGTGCTCGACTTTTTGCTGGGAAAGGCAAAGTAGAAAT
TCAGGCTCAAGGTGATGGCTTGGATGTCATTGCTCGAAAAGGTGTACAGATTACTTCAACCGAAGACACA
GTTTATATTACTAGCCCAACTGAGATTAATCTGACAGCAAACGGATCTCAAGTTAAGCTGAACGATTCAG
GTATTTTCCCTGTCACGGGTGGTAAGCTTGAGGTGAAAGCTGGGCAGCACTTGTTTAGGGGAGGGTCATC
AATAAATCCACCTGCATTAGATTTACCAGACTGTTCGGCTAAGCAAACTCAAGCTGCTCAAAATGGTTCG
GCTAAGGTAGATTTATCATGA

Protein ID: 565638809
SecReT6 ID881
T6SS typei4b
Gene symbol-
Locus tagP795_10970
StrainAcinetobacter baumannii ZW85-1
Repliconchromosome [GenBank: NC_023028] [Browse all T6SS(s) in this replicon]
Location [Strand]2384097..2384504 [-]
Producthypothetical protein
NoteTssI
UniProt IDV5VET9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.40E-14, Aligned region: 45..133
Protein Sequence: 135 a.a.     [Download]
>gi|565638809|ref|YP_008891052.1| hypothetical protein P795_10970 [Acinetobacter baumannii ZW85-1]
MMSHKIFQILDSLGLVAQNRVLHVQFSNASLNNQVFLQRIEGEHTLNQGSVAELLCLSTNAHIALKQFIG
CQVAVDQVTDTGQFFRTTGIITEASQGQSDGSLTIYNLTLKDPTALWHKRRNSRVFMNKSVRDTR
 
Nucleotide Sequence: 408 bp     [Download]
>gi|565636615|ref|NC_023028.1|:c2384504-2384097 Acinetobacter baumannii ZW85-1, complete genome
ATGATGTCCCATAAAATATTTCAAATTTTAGATAGTTTAGGATTGGTCGCACAGAATCGCGTTCTTCATG
TGCAATTTTCCAACGCATCATTAAACAATCAAGTTTTTTTACAACGTATTGAAGGCGAACATACGCTTAA
TCAGGGCAGCGTTGCTGAGTTATTGTGTCTGTCGACAAACGCCCATATTGCATTAAAACAGTTTATTGGC
TGTCAGGTTGCCGTCGATCAGGTCACCGATACAGGCCAGTTTTTTAGAACGACAGGTATTATTACCGAAG
CTAGCCAAGGGCAAAGCGACGGCTCACTCACTATTTATAACCTCACCTTAAAAGACCCAACTGCACTCTG
GCATAAGCGCCGTAATAGTCGCGTGTTTATGAATAAAAGCGTGCGCGATACCCGTTAA