SecReT6
Protein ID: 565638809
SecReT6 ID881
T6SS typei4b
Gene symbol-
Locus tagP795_10970
StrainAcinetobacter baumannii ZW85-1
Repliconchromosome [GenBank: NC_023028] [Browse all T6SS(s) in this replicon]
Location [Strand]2384097..2384504 [-]
Producthypothetical protein
NoteTssI
UniProt IDV5VET9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.40E-14, Aligned region: 45..133
Protein Sequence: 135 a.a.     [Download]
>gi|565638809|ref|YP_008891052.1| hypothetical protein P795_10970 [Acinetobacter baumannii ZW85-1]
MMSHKIFQILDSLGLVAQNRVLHVQFSNASLNNQVFLQRIEGEHTLNQGSVAELLCLSTNAHIALKQFIG
CQVAVDQVTDTGQFFRTTGIITEASQGQSDGSLTIYNLTLKDPTALWHKRRNSRVFMNKSVRDTR
 
Nucleotide Sequence: 408 bp     [Download]
>gi|565636615|ref|NC_023028.1|:c2384504-2384097 Acinetobacter baumannii ZW85-1, complete genome
ATGATGTCCCATAAAATATTTCAAATTTTAGATAGTTTAGGATTGGTCGCACAGAATCGCGTTCTTCATG
TGCAATTTTCCAACGCATCATTAAACAATCAAGTTTTTTTACAACGTATTGAAGGCGAACATACGCTTAA
TCAGGGCAGCGTTGCTGAGTTATTGTGTCTGTCGACAAACGCCCATATTGCATTAAAACAGTTTATTGGC
TGTCAGGTTGCCGTCGATCAGGTCACCGATACAGGCCAGTTTTTTAGAACGACAGGTATTATTACCGAAG
CTAGCCAAGGGCAAAGCGACGGCTCACTCACTATTTATAACCTCACCTTAAAAGACCCAACTGCACTCTG
GCATAAGCGCCGTAATAGTCGCGTGTTTATGAATAAAAGCGTGCGCGATACCCGTTAA