SecReT6
Protein ID: 565642691
SecReT6 ID882
T6SS typeii
Gene symbol-
Locus tagM973_07550
StrainFrancisella noatunensis subsp. orientalis LADL--07-285A
Repliconchromosome [GenBank: NC_023029] [Browse all T6SS(s) in this replicon]
Location [Strand]1358765..1361227 [+]
Productpathogenicity deteminant protein pdpA
NotePdpA
UniProt IDV5W0E9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 820 a.a.     [Download]
>gi|565642691|ref|YP_008893537.1| pathogenicity deteminant protein pdpA [Francisella noatunensis subsp. orientalis LADL--07-285A]
MITISNITNLNILNIISQLASDVTSDSITPSSAQLACEVNDYITTHELKNIDVINLQLKTTKTLYKKKFI
SILEYRKYQQYCKLTQLKDSIDQFTLYFSSNNKDSKSLELAILELKKSCQSDLILKLPYDYIKKIDNLLN
IIDNAIQRSSSLNKTLLKHFNKLKNTLSKYIAYSSVIQKQEFVINIKPINESFEAQNINFISTNNKQYFK
QNSLTLKNSHIKNLKICENIYGISGDLTFNLAYVNNHKDFDFLLTPNQPILIDIQINDSFNFYKKDSKKE
HHVRSSRFVVVGFNSNNIDVNEDFEYSIYSYSKNTSSGVKEFKIKFHDPLKAFWSKHKPSYIDINKSLDD
IFKDNFFFNSLFSLDANKSDKLRSRIPQVFISTVNRSFYDFFIDQLEQNKTYLKYFCNKKNGKVTYYVVD
EVDSSLQNNISNSDENLKTKLSPYDISCIKKQSLIANKPNLYIKENDISPDVTINNKRKEERKTSNASAK
PFSSIYKDNFQAVQYLQNSNNKNEEVSSSEFQILLTSKNTLPFMDSEISLSKLENDNSFLLGTIAIKNLL
IYERKLSFSRSKYTTRELYKNLDRLHYKTDSESDVYEKIAFTKILNRTHDNSLTYRIKSYSNIAPEYPNY
KTFDRFYINGKITIGENVNNDSKKAYKFFKNYKPEESSLSEFQESGEKGTSVIQNSKTSIFYAVEIAKEI
LPDKSSEKPIIYLPMKVNINSANNQFMPLRNDDIILIEVQSFESAEIIQLISNSAISTEKAQQQLLQRQL
LGAKENCEMAYTQTSDGETFSLTQLNEACENSFLINNKKGIFLRYKSKGN
 
Nucleotide Sequence: 2463 bp     [Download]
>gi|565641727|ref|NC_023029.1|:1358765-1361227 Francisella noatunensis subsp. orientalis LADL--07-285A, complete genome
ATGATAACTATTAGTAATATAACCAACTTAAATATACTCAATATAATCAGTCAATTAGCTTCCGATGTTA
CAAGTGATAGTATCACCCCTTCGTCTGCTCAACTTGCCTGTGAAGTTAATGACTATATAACTACTCATGA
GTTAAAAAACATTGATGTTATTAATCTACAACTTAAAACAACTAAGACACTTTATAAAAAAAAATTCATA
TCCATACTTGAATATAGGAAATATCAACAATACTGTAAACTTACTCAACTAAAAGACAGCATAGATCAAT
TTACATTATATTTTTCATCAAACAATAAAGATTCCAAAAGCCTAGAGTTAGCCATTTTAGAATTAAAGAA
GTCATGTCAGTCGGATTTGATTCTTAAATTACCTTATGATTACATCAAAAAAATAGACAACCTCCTAAAC
ATTATTGACAATGCAATTCAAAGATCTAGCTCTTTGAATAAAACTCTTCTAAAACATTTTAATAAACTAA
AAAATACTCTTTCAAAATATATTGCCTACAGCTCAGTAATACAAAAACAAGAATTTGTAATAAATATAAA
ACCTATTAATGAAAGTTTTGAAGCTCAAAATATTAACTTCATATCTACAAATAACAAACAATACTTTAAA
CAAAATTCTCTTACACTCAAAAACTCACATATTAAAAATCTAAAAATATGTGAAAATATCTATGGAATAA
GCGGAGATTTAACTTTTAACTTAGCATATGTAAATAACCATAAAGATTTTGATTTTTTGTTAACTCCAAA
TCAACCTATATTGATAGATATTCAAATTAATGATAGCTTCAATTTCTATAAAAAAGATTCTAAGAAAGAG
CATCACGTTAGATCAAGTCGTTTTGTTGTCGTAGGATTTAATTCAAACAATATAGATGTTAATGAAGATT
TTGAGTACAGTATTTACTCTTACTCTAAAAATACTTCTTCGGGCGTGAAAGAATTTAAAATAAAATTTCA
CGATCCTTTGAAAGCGTTTTGGTCAAAACATAAGCCTTCTTATATCGATATTAATAAAAGTTTGGATGAT
ATCTTTAAAGACAACTTTTTCTTTAATAGTTTGTTTTCTTTAGATGCAAACAAAAGCGATAAATTGAGAA
GCCGAATACCACAAGTATTTATTTCAACGGTGAATAGAAGCTTTTATGATTTTTTTATTGATCAGCTTGA
GCAAAACAAAACCTACTTAAAATATTTCTGTAACAAAAAAAATGGCAAGGTAACGTACTATGTTGTTGAT
GAGGTAGATAGCTCCTTACAAAATAACATTTCAAACTCTGATGAGAATTTAAAAACTAAGCTGTCTCCTT
ATGATATAAGCTGTATCAAGAAACAATCTCTAATAGCTAATAAGCCAAATCTTTATATTAAAGAAAATGA
TATATCTCCTGATGTAACTATTAATAACAAAAGAAAAGAAGAACGAAAAACTTCTAATGCCTCAGCAAAA
CCCTTCTCATCAATATATAAAGATAATTTCCAAGCCGTACAATACCTACAAAATAGTAACAATAAAAATG
AAGAAGTTAGCTCTTCAGAGTTTCAAATATTATTAACTTCAAAAAACACCCTTCCATTTATGGATAGCGA
GATTAGTTTATCCAAGCTAGAAAATGATAATAGTTTTCTTTTAGGAACGATAGCTATAAAAAATCTACTT
ATATATGAAAGAAAATTATCATTTTCAAGAAGTAAATATACCACTAGAGAGTTATATAAGAATCTAGATA
GATTACATTACAAAACTGATTCTGAATCAGATGTATATGAGAAAATAGCTTTTACAAAAATTCTTAATCG
AACTCACGATAACTCTTTGACATATAGAATTAAAAGCTATAGCAATATAGCTCCAGAGTATCCCAACTAT
AAAACATTTGATAGATTTTATATTAACGGCAAAATAACAATCGGAGAAAACGTTAATAATGATTCAAAAA
AAGCTTATAAATTCTTTAAAAACTATAAACCTGAAGAAAGCTCACTCTCAGAATTTCAAGAAAGTGGAGA
AAAAGGAACATCTGTTATACAAAACAGTAAGACCAGTATTTTCTATGCAGTAGAAATCGCTAAAGAGATA
TTGCCTGATAAATCCTCTGAAAAGCCAATTATATACCTACCTATGAAGGTAAACATAAATTCTGCTAACA
ACCAATTTATGCCTCTTAGAAATGATGATATTATCTTAATTGAGGTTCAATCATTCGAAAGTGCCGAGAT
AATCCAACTAATCTCAAATTCAGCTATTTCAACAGAAAAAGCACAGCAACAGCTTTTACAAAGGCAGCTT
CTTGGAGCTAAAGAAAACTGTGAAATGGCATATACACAAACAAGTGATGGCGAGACATTCTCACTAACTC
AACTTAATGAAGCTTGTGAGAATTCTTTTTTAATAAACAATAAAAAAGGGATCTTTCTTAGATACAAATC
AAAAGGGAATTAA