SecReT6
Protein ID: 565642692
SecReT6 ID882
T6SS typeii
Gene symbol-
Locus tagM973_07555
StrainFrancisella noatunensis subsp. orientalis LADL--07-285A
Repliconchromosome [GenBank: NC_023029] [Browse all T6SS(s) in this replicon]
Location [Strand]1361231..1364500 [+]
Productribosomal L29e protein family
NotePdpB
UniProt IDV5VYU7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1215 [PF06744], Evalue: 0.0015, Aligned region: 843..948
Protein Sequence: 1089 a.a.     [Download]
>gi|565642692|ref|YP_008893538.1| ribosomal L29e protein family [Francisella noatunensis subsp. orientalis LADL--07-285A]
MTFIKNHQILIISLAIIVIILSVIGIFFIRRWLKASKSSNRKPISKIVKRAKSVIKTNKIKNNLGELYIF
YGDHLAAKQYIMKIKPNAQIIDNDELPLIVIDKNNPSFVFANDDLSNLYKFKNKLNLQFYKLNFCIDISN
THENNNINEIYKELSKLRLKNFIISFYTSSEHYQRYNNAIGKKSIFELTSNENSNNVDEAILLKILSNKD
DVDDKYHNIKILNQIRKTLKNIYPQLKSIDKDVFINFSLNIPDNIIAKRDTIFFSSSPKGIIINLISLLF
SCIFIINIFQQIGLKDKISIKNLDPSSKINAHQILKEARKEIEDTLLLDILYPKSIKYHFIYEQYANALL
KNVILPKYNDSYDLSMITSFLIFFEYLNNKDVNQETDGMLRIISRFTNLSEKQLEVVIKYTNRDLKVGTI
KTVISRANKLYTNPLLVLGEDSESYLSTQGFNAEYLGISNTKRAKFINDIYIKYLYKCTIDNSILDLKNN
YIIPIEVNNIFSMYQEQFDISSKKLCNSSYISSVTKSVSLIFNQEESERKFESFRDMLDRIYYLVESLEK
NANDVTDEGKEQTGLITVSLVNYVLNSVVNSTYNKDGHPLINPVSKKLYMEFAPNFYSKKILISPIYSKE
YIKDNIEPINKKFDRLLNNLKSNFNIEPDFIIAIYKSSINNYNSKYINSYNRMIDRLNNDTEFSKNISNK
NALNLYLLAMSSKDSSFNSLMEFYSSNTDLVSDESETNPTKKINKLQQFYGKIVKLGKQNDYKEQNDVSL
WTPVDNYFKENDEYLKSKNYIDYREVYKQLNNLIRKQGYSATYKEIKQGYKPLQKVYSDLSEINNPNNNN
LYKLLKKHLDVTIDTIKTIAIQDAITKLDNTVNIEYEFINSQFPFNKDSNTIATNEMITKDFDSNGYIYS
AFVEQLSPLLSYDKTDDKWHSEDFSTSEQINYLNKFNKAYLLNKLLWDEKRNPQSIKFEITPIPNKDNDY
TFFSIILDKQNYVNSLNIAYSNSMEINYNWNSLVSTTITIKFEDGSTDRISYHGKWSILKAIKDANCDGN
NICTWEVKHNGKTYPVSFKVKSKFLQVLGWQKQGDTDVQ
 
Nucleotide Sequence: 3270 bp     [Download]
>gi|565641727|ref|NC_023029.1|:1361231-1364500 Francisella noatunensis subsp. orientalis LADL--07-285A, complete genome
ATGACTTTTATAAAAAATCATCAAATATTAATAATTTCTCTAGCAATAATAGTAATTATATTGTCAGTTA
TAGGTATTTTCTTTATAAGAAGATGGCTAAAAGCATCAAAATCTTCTAATAGAAAACCTATTTCAAAAAT
TGTAAAACGGGCAAAATCTGTTATTAAAACAAATAAGATAAAAAACAACTTGGGTGAGCTCTATATATTC
TATGGAGACCATTTAGCAGCAAAACAGTATATAATGAAAATAAAGCCTAATGCTCAAATCATTGATAATG
ATGAATTACCTCTAATAGTTATTGATAAAAACAACCCTTCATTCGTATTCGCAAACGATGATCTTTCGAA
TCTATACAAATTTAAAAACAAATTAAACTTGCAATTTTATAAGCTTAATTTTTGTATTGATATCTCTAAT
ACTCACGAAAATAACAATATAAACGAGATTTATAAAGAACTATCAAAACTAAGATTAAAAAATTTTATTA
TATCTTTCTATACATCATCTGAACATTACCAACGCTATAATAATGCTATTGGTAAGAAGTCAATATTCGA
ATTAACTTCAAATGAAAATTCAAATAATGTTGATGAGGCTATACTCTTAAAAATCCTTAGCAATAAAGAT
GATGTTGATGATAAATATCATAATATTAAAATATTAAATCAAATAAGAAAAACGTTAAAAAACATCTACC
CTCAGTTAAAATCAATTGACAAGGATGTATTTATTAACTTTAGTCTAAATATACCAGATAACATAATAGC
TAAAAGAGATACAATCTTTTTTAGTAGTTCTCCCAAAGGCATTATCATTAATTTAATATCTCTACTATTT
AGCTGTATATTTATTATTAATATTTTTCAACAGATTGGATTGAAAGATAAGATCTCTATAAAAAACTTAG
ATCCTTCATCTAAAATTAATGCTCATCAAATTTTAAAAGAGGCTAGAAAAGAAATTGAAGATACTTTGCT
TCTTGATATTTTGTATCCAAAATCAATAAAATATCATTTTATTTACGAGCAATATGCTAATGCTCTACTA
AAAAATGTAATTTTACCAAAATATAATGACTCATATGACTTATCAATGATCACATCATTCTTAATATTTT
TTGAATATTTAAATAATAAGGATGTAAATCAAGAAACTGACGGTATGCTTAGAATAATAAGCCGTTTCAC
AAACCTGTCCGAAAAGCAGCTAGAGGTTGTAATCAAGTATACAAATCGCGATTTGAAAGTTGGAACAATT
AAAACTGTTATTAGTAGAGCTAATAAGTTATATACAAATCCCCTGTTAGTTTTAGGAGAAGATTCTGAGA
GTTATTTAAGTACACAGGGCTTCAATGCTGAGTATCTAGGAATATCAAATACTAAAAGAGCTAAATTCAT
CAATGATATATATATAAAATACCTGTATAAATGTACCATCGACAACTCCATACTAGACTTAAAAAATAAT
TACATAATACCAATTGAAGTAAACAACATTTTCTCAATGTATCAAGAACAATTTGACATATCATCAAAAA
AATTATGTAATTCATCATACATAAGCTCAGTCACAAAAAGTGTCTCTTTAATATTTAATCAAGAGGAAAG
TGAAAGAAAATTTGAAAGCTTTAGAGATATGCTAGATCGCATTTATTATTTAGTAGAGTCTTTAGAAAAA
AATGCTAATGACGTTACCGATGAAGGCAAAGAGCAAACAGGATTGATAACCGTTTCTCTAGTAAATTATG
TTCTAAATAGTGTCGTCAATTCTACATATAATAAAGATGGACATCCATTAATAAATCCTGTAAGTAAGAA
ACTGTATATGGAATTTGCACCTAATTTCTACAGTAAAAAAATATTAATATCGCCTATTTATTCAAAAGAA
TATATTAAAGATAACATAGAGCCTATCAACAAAAAATTCGATAGACTTCTTAATAATCTTAAAAGTAACT
TTAACATAGAGCCTGACTTTATAATTGCTATTTATAAGAGCTCTATAAACAATTACAATTCAAAATATAT
AAATTCTTATAATAGAATGATAGATCGACTCAACAATGATACTGAATTTAGTAAAAACATCTCGAATAAA
AATGCTCTAAATCTTTATTTGCTAGCTATGTCATCGAAAGACTCTTCTTTCAATAGTTTAATGGAGTTCT
ATAGCTCAAATACAGATTTAGTAAGCGATGAATCTGAAACAAATCCAACTAAAAAAATCAATAAGCTTCA
ACAATTCTATGGAAAAATAGTTAAATTAGGTAAACAAAATGATTATAAAGAACAGAATGATGTTTCACTT
TGGACACCTGTAGATAATTATTTTAAAGAGAATGACGAATACCTTAAATCAAAAAATTATATTGACTATA
GAGAAGTCTATAAACAGTTAAACAATTTAATAAGAAAGCAAGGCTATTCAGCCACTTATAAAGAAATTAA
GCAAGGATATAAACCTCTACAAAAAGTTTATTCTGACCTTTCAGAAATAAATAATCCAAACAATAATAAC
TTGTATAAATTACTGAAAAAGCATCTTGATGTTACTATTGACACTATCAAAACCATAGCTATACAAGATG
CGATAACTAAACTCGATAATACTGTCAATATTGAGTATGAATTTATAAATAGTCAATTCCCATTTAATAA
AGATAGTAATACTATAGCCACAAATGAAATGATAACTAAAGATTTTGATAGTAATGGTTATATATATTCA
GCATTTGTAGAGCAATTATCTCCACTACTATCTTATGATAAGACCGATGATAAGTGGCATAGTGAAGATT
TTTCAACTTCTGAGCAAATAAATTACTTAAATAAATTTAATAAAGCTTACTTATTAAACAAACTATTATG
GGATGAAAAAAGAAATCCTCAATCTATCAAGTTTGAGATAACTCCTATACCAAATAAGGATAATGATTAT
ACCTTCTTTAGTATAATCCTCGATAAGCAAAATTATGTAAATTCTCTGAATATAGCATACTCAAATAGTA
TGGAAATTAATTACAATTGGAACTCACTTGTATCAACGACTATAACTATAAAATTTGAAGATGGCAGCAC
TGATCGAATAAGCTACCATGGTAAATGGTCTATATTAAAAGCAATTAAAGATGCAAATTGTGATGGAAAT
AATATTTGTACTTGGGAGGTTAAACATAATGGTAAAACATACCCCGTAAGCTTTAAAGTCAAATCAAAAT
TTTTACAAGTATTAGGTTGGCAAAAACAAGGAGATACTGATGTACAATAA