SecReT6
Protein ID: 565642693
SecReT6 ID882
T6SS typeii
Gene symbol-
Locus tagM973_07560
StrainFrancisella noatunensis subsp. orientalis LADL--07-285A
Repliconchromosome [GenBank: NC_023029] [Browse all T6SS(s) in this replicon]
Location [Strand]1364490..1364867 [+]
Producthypothetical protein
NoteIglE
UniProt IDV5VYN6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam LPAM_1 [PF08139], Evalue: 0.00024, Aligned region: 2..24
Protein Sequence: 125 a.a.     [Download]
>gi|565642693|ref|YP_008893539.1| hypothetical protein M973_07560 [Francisella noatunensis subsp. orientalis LADL--07-285A]
MYNNLFKKVSLILVIALGLSSCASNGLYINNNVPKTKIVLESKPNKNTFYSDNYQSISQRIYDDNVKVLN
LKTGDNEFPLNKDSKDYALYFILPDNKSIENWKYIISSDSVNEFTIKNDSSIEKD
 
Nucleotide Sequence: 378 bp     [Download]
>gi|565641727|ref|NC_023029.1|:1364490-1364867 Francisella noatunensis subsp. orientalis LADL--07-285A, complete genome
ATGTACAATAACTTATTTAAAAAAGTTTCATTAATATTAGTTATAGCTCTAGGGCTTAGTAGTTGTGCAA
GTAATGGTTTGTATATCAACAATAATGTGCCTAAAACAAAAATAGTCCTAGAGTCAAAGCCCAATAAAAA
TACTTTCTACTCTGATAATTATCAATCAATTTCTCAAAGAATATATGATGATAATGTAAAAGTATTAAAT
CTAAAAACTGGAGACAATGAGTTCCCACTTAATAAAGATAGTAAAGACTACGCTTTGTATTTCATATTAC
CTGATAATAAGAGCATTGAGAACTGGAAATATATAATAAGCTCAGACTCTGTAAATGAATTTACTATAAA
AAATGATAGTAGCATAGAAAAAGACTAA