SecReT6
Protein ID: 565642695
SecReT6 ID882
T6SS typeii
Gene symbol-
Locus tagM973_07570
StrainFrancisella noatunensis subsp. orientalis LADL--07-285A
Repliconchromosome [GenBank: NC_023029] [Browse all T6SS(s) in this replicon]
Location [Strand]1365380..1367092 [+]
ProductDNA polymerase I
NoteIglF
UniProt IDV5VYZ0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 570 a.a.     [Download]
>gi|565642695|ref|YP_008893541.1| DNA polymerase I [Francisella noatunensis subsp. orientalis LADL--07-285A]
MDNTVDKEFRNLFENISIYYDQERSFRINKIDECIDNIIKVQDKTSYTKFDLYNLKYLIEDIKYSTNLIL
SDTSKRLCKQILKVTDNILDCTDTKLFISHFNDLKKLLNDYKSVINKDILYRTELTKTKKINELESILFN
ILEADDLESYSDMLIQLYTRTINNRQSENLIERYKEYFYSLKNFIKNYQGINCLLPFKENPLLSLLNLAY
VIKNGIYKTDTLLASDLILLRAFYSTIQDTTKLNIINDKTNINLITSLASIKEEQPSENLEKIIDFIDLQ
IFSISRYFDDFDLDDIFFYKTIKKTPKPESFEQLVLNLKNIPNIIFDEESLYKMINQESELYKKLFVNDN
HNNPIEKIIEESPANLLTRIFNKYFQALLEIATSINLALFDKDFELIYPFVEFEKHLKIIAMEIANKSNF
NRQKIEKSIKEVHKTYHLLKSNYSLLEAREQKIIKEKNGIEKLSLFIDKKNFLTYKQIKTSIPNNKGVNI
DKHLVKINKNISNSNYATATEKAKELTIFLLNQAYYKCPSLIGVYDLPPFSNNYFLALKEITDSPIIDKL
KNKQEAYWSV
 
Nucleotide Sequence: 1713 bp     [Download]
>gi|565641727|ref|NC_023029.1|:1365380-1367092 Francisella noatunensis subsp. orientalis LADL--07-285A, complete genome
ATGGATAATACTGTCGATAAAGAGTTTAGAAATTTATTTGAAAATATCAGTATATACTATGATCAAGAAA
GATCTTTTAGAATAAACAAAATTGACGAATGTATCGACAATATTATCAAAGTTCAAGATAAAACTAGTTA
TACAAAATTTGATTTGTATAATCTTAAATATCTTATTGAAGATATTAAATATTCAACAAATCTTATATTA
TCTGATACATCAAAAAGACTTTGCAAGCAAATACTGAAGGTTACAGATAATATTTTAGATTGTACTGATA
CTAAATTATTTATAAGTCACTTTAATGATTTAAAAAAATTACTTAATGACTACAAATCCGTAATTAATAA
AGATATATTGTACAGAACAGAGCTTACAAAAACTAAAAAAATTAATGAATTAGAGTCTATACTTTTTAAT
ATTTTAGAAGCTGATGATTTGGAAAGTTATAGTGACATGCTTATACAACTATATACTAGAACCATTAATA
ATCGTCAATCTGAAAATCTTATAGAGAGATATAAAGAATATTTTTATTCACTCAAGAATTTTATAAAAAA
TTATCAAGGTATAAATTGTCTTCTTCCTTTTAAAGAAAATCCTCTACTAAGCTTATTAAACTTAGCTTAT
GTAATTAAAAATGGAATTTACAAAACAGATACCCTCTTAGCTAGTGATCTTATACTTTTAAGAGCTTTTT
ATTCGACAATACAGGATACTACAAAATTAAATATCATTAATGACAAAACAAATATAAACCTTATTACTTC
ATTAGCATCTATAAAAGAAGAACAACCTTCAGAAAATTTAGAAAAAATTATCGATTTTATAGATTTACAA
ATTTTTAGCATATCTCGATATTTTGATGATTTTGACCTAGATGATATTTTTTTTTACAAAACTATAAAAA
AGACTCCCAAACCAGAATCATTTGAACAACTAGTATTAAATCTAAAAAATATCCCAAACATTATTTTTGA
TGAAGAATCTTTGTACAAAATGATTAATCAAGAGAGTGAGCTTTATAAAAAGTTATTCGTAAATGACAAT
CACAATAATCCCATAGAAAAAATCATAGAAGAATCACCTGCAAATTTACTGACTAGAATATTTAACAAAT
ATTTCCAAGCTTTATTAGAAATAGCTACATCGATAAACCTTGCATTATTTGATAAAGATTTTGAACTGAT
ATACCCTTTTGTCGAATTTGAAAAACATCTAAAAATAATTGCTATGGAAATAGCAAACAAATCCAATTTT
AATCGACAAAAGATAGAGAAATCTATAAAAGAGGTTCATAAAACATATCACCTACTAAAATCTAATTACT
CCTTATTGGAGGCTAGAGAGCAAAAAATAATTAAAGAAAAAAATGGAATAGAAAAACTTAGTCTTTTTAT
TGATAAAAAAAACTTTTTAACATATAAGCAAATCAAAACATCTATACCCAACAATAAAGGAGTAAACATA
GATAAGCACTTAGTAAAAATAAATAAAAATATTTCTAACTCAAATTATGCAACTGCTACAGAAAAAGCTA
AGGAGTTAACTATCTTTCTTTTAAATCAAGCATACTATAAATGTCCTTCTCTCATCGGAGTATATGATTT
ACCCCCTTTTTCGAATAATTACTTCTTAGCACTCAAAGAGATTACAGATAGTCCAATTATAGATAAATTA
AAAAATAAGCAAGAAGCTTACTGGAGTGTGTAA