SecReT6
Protein ID: 565642696
SecReT6 ID882
T6SS typeii
Gene symbol-
Locus tagM973_07575
StrainFrancisella noatunensis subsp. orientalis LADL--07-285A
Repliconchromosome [GenBank: NC_023029] [Browse all T6SS(s) in this replicon]
Location [Strand]1367092..1367613 [+]
Producthypothetical protein
NoteIglG
UniProt IDV5W0F4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF4280 [PF14107], Evalue: 4.30E-18, Aligned region: 58..167
Protein Sequence: 173 a.a.     [Download]
>gi|565642696|ref|YP_008893542.1| hypothetical protein M973_07575 [Francisella noatunensis subsp. orientalis LADL--07-285A]
MLDIINDSLKRLETISNNDENIKGSISNLVSELNNIKILLSPTELNLSSSASTLTPSMTAQIKCSFSLAP
GVYLSTRVKTLAGNLPASNITDSKLGANILPFAGCTNPANPTMNPFVFPWVCIPNLSPFIPTNPTTLLEG
APITTMNSKAMCTFAPGGIVNFISSGQINVKTS
 
Nucleotide Sequence: 522 bp     [Download]
>gi|565641727|ref|NC_023029.1|:1367092-1367613 Francisella noatunensis subsp. orientalis LADL--07-285A, complete genome
ATGCTAGATATTATAAATGACTCACTAAAACGATTGGAAACAATATCTAACAATGATGAAAATATTAAAG
GCTCAATATCTAATCTGGTATCAGAACTCAATAATATAAAAATATTACTAAGTCCAACAGAACTTAATCT
GTCCAGTAGTGCTTCTACGTTGACACCTTCGATGACTGCGCAAATCAAATGCTCATTTAGTCTCGCACCT
GGAGTCTATTTAAGTACTAGAGTAAAAACACTAGCAGGTAATTTACCAGCTTCAAATATTACTGATTCTA
AACTTGGTGCTAATATACTTCCTTTTGCAGGATGTACCAACCCAGCAAATCCAACGATGAACCCTTTTGT
TTTCCCTTGGGTTTGCATACCTAATCTTTCTCCTTTTATACCAACAAATCCAACCACTCTATTAGAAGGA
GCACCAATAACTACTATGAATAGCAAAGCAATGTGTACTTTTGCCCCTGGAGGCATTGTTAACTTCATAA
GTAGTGGACAAATTAATGTAAAAACATCTTAA