SecReT6
Protein ID: 565642697
SecReT6 ID882
T6SS typeii
Gene symbol-
Locus tagM973_07580
StrainFrancisella noatunensis subsp. orientalis LADL--07-285A
Repliconchromosome [GenBank: NC_023029] [Browse all T6SS(s) in this replicon]
Location [Strand]1367625..1369052 [+]
Producthypothetical protein
NoteIglH
UniProt IDV5VYV2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 475 a.a.     [Download]
>gi|565642697|ref|YP_008893543.1| hypothetical protein M973_07580 [Francisella noatunensis subsp. orientalis LADL--07-285A]
MSEIKNNLSRNDAAILKKTFDKLSIDIKADFDKRISDYSNSLLFKYYSNLYYFLPKSCLLEIKDKGHNGY
YIRPQEYFFIEDKRTNRSLTYTTRSESLILPLKNITTIKQSDTLINVSLEFENNFEYDYITIWLDPRLCE
EDPFFATYIFNQILVSNSFVKIKFSDYSYTTKDITTEPINLQLKPTEKLVLNIHSPSLMYGFNIRIKDLF
KYKHNNLKKIDLSFNIKTDNFSEEKLSSLFRANLVPIFNSFDDYSSATFTTLNLSDSKLKHHQTDNAQAI
EVLSIYENNKPCSFDGFLFSGQNEYYLNRNTQSLNYSIVFPELNNKILETKIHTYTTWTQLAEVSDLIEI
NSNTITSINSSISPIFINKAIENYNSNSRDMFNMVDMIISKNMYSKTTFLAIAKLLKTDDNNISLLSSLL
DKVELDSVINELILTTSNRYNEKYKYFLDFFIGIICKFINQNTFSFIKKIVLNNS
 
Nucleotide Sequence: 1428 bp     [Download]
>gi|565641727|ref|NC_023029.1|:1367625-1369052 Francisella noatunensis subsp. orientalis LADL--07-285A, complete genome
ATGAGTGAAATAAAAAATAATCTAAGTAGAAATGATGCTGCTATTTTAAAGAAAACTTTTGATAAATTAA
GTATCGATATAAAAGCTGACTTTGATAAAAGAATTTCTGACTATAGCAACAGCCTCTTATTCAAATACTA
TAGTAATTTATATTATTTTCTCCCCAAATCGTGTTTATTAGAAATAAAAGATAAAGGTCATAATGGTTAC
TATATTCGTCCTCAAGAATATTTTTTTATTGAAGATAAGAGAACTAATAGATCTTTAACATATACAACTA
GATCAGAAAGTCTTATCTTACCATTAAAAAATATAACTACAATCAAACAAAGCGATACTTTAATAAACGT
ATCTTTAGAGTTTGAGAATAATTTTGAATATGACTATATTACTATTTGGCTAGATCCTAGATTATGTGAA
GAAGATCCTTTTTTTGCAACGTATATTTTTAATCAAATATTAGTAAGTAATAGCTTCGTCAAAATTAAAT
TTTCTGATTATTCCTATACGACTAAAGATATAACAACAGAGCCTATTAACCTACAACTTAAACCTACAGA
AAAGTTAGTGCTCAATATTCACTCACCTAGTTTGATGTATGGATTCAATATAAGAATTAAAGATCTGTTT
AAATATAAGCACAACAACTTAAAAAAAATAGATCTTAGCTTCAATATTAAAACCGATAATTTTAGTGAAG
AAAAACTATCCTCACTGTTTAGAGCAAACTTAGTACCCATATTTAATAGTTTTGATGATTATTCAAGTGC
TACATTTACTACATTGAACTTATCAGATAGTAAACTTAAACATCATCAAACAGACAATGCCCAAGCAATA
GAAGTATTATCTATATATGAAAATAATAAACCCTGCTCCTTCGATGGTTTTCTTTTTTCGGGTCAAAATG
AATATTACCTCAATAGAAATACTCAATCACTAAATTACAGCATAGTTTTTCCTGAACTTAATAATAAAAT
ACTAGAAACAAAAATCCATACTTATACAACATGGACACAATTAGCTGAGGTTTCTGATCTTATTGAAATT
AATTCAAATACAATAACATCTATAAACTCAAGTATCTCTCCAATATTTATAAATAAAGCTATAGAAAACT
ACAACAGCAACTCTAGAGATATGTTTAATATGGTAGATATGATTATATCTAAGAATATGTACTCAAAAAC
AACATTTCTAGCTATAGCAAAACTTTTAAAGACTGATGATAATAATATATCATTACTATCAAGTCTATTG
GATAAAGTGGAATTAGACTCGGTAATTAACGAACTAATTCTAACCACAAGCAATAGATATAATGAGAAAT
ATAAATATTTCTTAGATTTTTTTATAGGTATTATATGTAAGTTCATAAACCAAAATACCTTTAGCTTTAT
AAAAAAAATTGTTTTGAATAACTCTTGA