SecReT6
Protein ID: 565642698
SecReT6 ID882
T6SS typeii
Gene symbol-
Locus tagM973_07585
StrainFrancisella noatunensis subsp. orientalis LADL--07-285A
Repliconchromosome [GenBank: NC_023029] [Browse all T6SS(s) in this replicon]
Location [Strand]1369067..1369687 [+]
Productdevelopmental protein
NoteDotU
UniProt IDV5VYP1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.10E-10, Aligned region: 27..203
Protein Sequence: 206 a.a.     [Download]
>gi|565642698|ref|YP_008893544.1| developmental protein [Francisella noatunensis subsp. orientalis LADL--07-285A]
MADFVEIEIILDIIKSTREITKEKYVDNEQIAYYRNNIRKSIFFLQEELLEKYSETICKYITFPIIAYVD
EKLMILKEESGSGISWGLLQLEYYDRKDGGEYVFKIIDNLLSDNIYPQLCYQTVSLILNNDFYGKYYENI
YNHNFLAYKKEVIKHIDRSVVDSISFIDTSNSPTPPKKHHKIAKFLLRFGVPIALFLISLLIFLSW
 
Nucleotide Sequence: 621 bp     [Download]
>gi|565641727|ref|NC_023029.1|:1369067-1369687 Francisella noatunensis subsp. orientalis LADL--07-285A, complete genome
ATGGCAGATTTTGTAGAAATAGAAATTATTCTAGACATTATAAAAAGTACAAGAGAGATCACTAAAGAAA
AGTATGTTGATAATGAACAAATTGCATACTATCGTAACAATATTAGAAAAAGTATATTTTTTCTTCAAGA
AGAGCTATTAGAAAAATATAGTGAAACAATATGTAAATACATAACATTTCCAATAATTGCGTATGTCGAT
GAAAAATTAATGATTCTAAAAGAGGAATCAGGAAGTGGTATTTCTTGGGGATTATTACAATTAGAATACT
ACGATAGAAAAGATGGTGGCGAATATGTTTTTAAAATAATTGATAACCTATTATCAGATAATATTTATCC
ACAATTATGTTATCAAACAGTGTCACTGATTCTCAATAATGATTTTTATGGTAAATACTATGAAAATATT
TATAACCATAATTTCCTTGCATATAAAAAAGAAGTTATTAAGCATATAGATAGATCTGTAGTTGACTCAA
TTAGTTTTATTGATACTTCCAATAGCCCAACTCCTCCCAAAAAACATCACAAAATTGCAAAATTCTTATT
AAGATTTGGTGTTCCTATTGCCCTATTCCTTATAAGTTTATTAATTTTTTTAAGTTGGTAA