SecReT6
Protein ID: 565642699
SecReT6 ID882
T6SS typeii
Gene symbol-
Locus tagM973_07590
StrainFrancisella noatunensis subsp. orientalis LADL--07-285A
Repliconchromosome [GenBank: NC_023029] [Browse all T6SS(s) in this replicon]
Location [Strand]1369702..1370898 [+]
Productphage tail protein
NoteIglI
UniProt IDV5VZ67
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Transketolase_N [PF00456], Evalue: 0.00035, Aligned region: 2..40
Transketolase_N [PF00456], Evalue: 0.00035, Aligned region: 112..202
Protein Sequence: 398 a.a.     [Download]
>gi|565642699|ref|YP_008893545.1| phage tail protein [Francisella noatunensis subsp. orientalis LADL--07-285A]
MSKLISVLNNIELETQDRINLISNMQIHAKYENAEYDQFIEKVVTNTNDTKSIDIYSLFLCLNSEICLTL
DQIDKISEIIESYFSILESRFSNISPSDSKQKNELAEKGINKFLIIIDANLSEIKNLEIISSANTDNIMD
LINKLIAFFDENNLSYDSDLKIQLSKTLNKLKNTLTLEEQKNQNEEQEPIQTTKKVTTNSKQAEPATMAN
TQGSEKWLSLVEKIEVLKSLVDSQRIFETSIVYDDIQNLLANFDPKEYFPEVFFPLYKKIAPIIGDIHKN
IDYYSSSIQWSVAKKMYEIDYNQFLDNLERMPENNFLNSASSLAQDHFYETNSEAKKQYRENNKILEDSE
AHKSNINIKTKIKKTTNDPQNIMDSEDDIQNTNNDNISDDDLNKLFDF
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|565641727|ref|NC_023029.1|:1369702-1370898 Francisella noatunensis subsp. orientalis LADL--07-285A, complete genome
GTGAGTAAGTTAATATCAGTTTTAAATAACATAGAGCTAGAAACTCAAGATAGAATAAATCTTATCAGTA
ATATGCAAATTCATGCAAAATATGAAAACGCAGAGTACGATCAATTTATAGAGAAAGTAGTTACTAATAC
TAATGACACAAAAAGCATAGATATATACAGTTTATTCCTTTGCTTAAATTCAGAAATATGTTTAACTTTA
GATCAAATTGACAAAATTTCTGAGATTATTGAGAGTTATTTTTCAATTTTAGAAAGCAGATTTTCTAATA
TTAGTCCCTCAGACTCTAAACAAAAAAATGAACTTGCGGAAAAAGGTATAAATAAGTTCTTAATTATAAT
TGATGCTAACCTTAGTGAAATTAAAAATTTAGAAATTATATCTTCTGCCAATACAGATAATATTATGGAC
CTAATAAATAAGCTGATAGCCTTTTTTGATGAGAATAATCTAAGTTATGATTCTGATTTAAAAATACAAC
TTAGTAAAACATTAAATAAGCTCAAAAACACACTTACTCTTGAGGAACAAAAAAATCAGAATGAGGAACA
AGAACCAATTCAAACAACTAAAAAGGTAACAACGAATAGTAAACAAGCCGAACCAGCTACAATGGCAAAT
ACTCAAGGTTCTGAGAAGTGGCTGTCTCTAGTTGAGAAAATAGAAGTACTAAAAAGCCTAGTAGATAGTC
AAAGAATATTTGAGACATCCATAGTTTATGATGATATCCAAAATTTATTAGCCAACTTTGATCCTAAAGA
ATATTTCCCTGAAGTTTTTTTCCCATTATACAAAAAGATCGCTCCAATCATTGGCGATATACATAAGAAT
ATAGACTATTACTCATCTAGTATCCAATGGAGCGTAGCAAAAAAAATGTATGAAATTGACTATAACCAGT
TTTTAGATAATCTTGAAAGAATGCCCGAAAATAATTTTCTCAATAGCGCATCATCACTAGCTCAAGATCA
TTTTTATGAAACAAACTCTGAAGCAAAAAAGCAATATAGAGAAAATAATAAAATATTAGAAGATAGTGAG
GCCCATAAGTCGAATATAAATATAAAAACAAAGATTAAGAAAACTACGAATGATCCTCAAAATATTATGG
ATTCGGAGGATGATATTCAAAATACTAATAATGATAATATTAGTGATGATGATTTAAATAAGCTATTTGA
CTTTTAA